SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g42870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g42870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g42870

Feature Type:gene_model
Chromosome:Gm01
Start:53994482
stop:53999148
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63470AT Annotation by Michelle Graham. TAIR10: AT hook motif DNA-binding family protein | chr1:23536831-23538863 REVERSE LENGTH=378 SoyBaseE_val: 1.00E-94ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0007000GO-bp Annotation by Michelle Graham. GO Biological Process: nucleolus organization SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0016458GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing SoyBaseN/AISS
GO:0016570GO-bp Annotation by Michelle Graham. GO Biological Process: histone modification SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0048449GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ formation SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF03479PFAM Domain of unknown function (DUF296) JGI ISS
UniRef100_G7KC38UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA-binding PD1-like protein n=1 Tax=Medicago truncatula RepID=G7KC38_MEDTR SoyBaseE_val: 9.00E-143ISS
UniRef100_I1JA69UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JA69_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g42870 not represented in the dataset

Glyma01g42870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g02610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g219600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g42870.1   sequence type=CDS   gene model=Glyma01g42870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGGGAGAGAAGGCATGGCATTTCCTGGTGGCTCTGTTCCATATTACATGCAGCATAGAGGAGGAGGGGTTAGTGGGTCTGGTCCAGGAACTGGGACACAGAGTGGAGGGTTTCAACCACCCTCTGGCTTTAGAGCTTTGTCAAATGTCTCTCCAGGTTCTGCATTTAAAGTAGAGTCTCATTCTTATTCTCATTCTCAGTCTCAGCCTCAGCATGCTAGTTTTAGTCATGGCATTAACATAGGTTCCTCTCCTGATGGTGGAGGTGGAGGACCTTCTTCTGGTGAGCCTGTGAAGAAGAAAAGAGGGAGGCCTAGGAAGTATGGCCCTGATGGATCTGTTTCATTGATGCTCTCTCCCATGTCTGCCACTGCTAGTTCCACGCCGGGATCAGGCACTTCTTCGGAGAAACGGCCCAGAGGGCGCCCACCTGGAAGTGGAAGGAAGCAACAGCTTGCCACTCTAGGTGAATGGATGAACAGTTCTGCAGGACTGGCTTTTTCACCTCATGTTATCACCGTTGGAGTTGACGAGGACATTGTAGCAAAGTTATTGTCATTTGCACGGCAGAGACCAAGGGCTGTGTGCATCTTAACAGGAACTGGGACAATTTCTTCAGTCACTCTGCGCCAGCCTGCTTCTACTAGCATCGGTGTCACTTATGAGGGCCGATTTCAAATATTATGCTTGTCTGGTTCATACTTGGTTGCTGAAGAAGGTGGACCTCACAATAGAACAGGTGGCATGAGTGTTTCCCTTTCTAGTCCTGATGGTCATATTATTGGTGGTGGTGTTACTAGGCTTGTTGCTTCAAGCCCAGTGCAGGTGGTAGCATGCAGTTTCGTATATGGGGGCTCCAAGCCAAAGACTAAACAAGTGACCACTACTACTACAGAAGATACCAGTTCAGAGCCTCAGAGTAGTGATAAGTTAGCTTCTCCAGGCAGTGTTCCTCCGCCTAATCAAAACTACACCTCTTCTCCTGCCCCAGGCATTTGGCCTGCATCATCAAGGCCAGTAGAGGTGAAAAGTGCACATGCACACACTGGTATTGACTTGACGCGTGGGTGA

>Glyma01g42870.1   sequence type=predicted peptide   gene model=Glyma01g42870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDGREGMAFPGGSVPYYMQHRGGGVSGSGPGTGTQSGGFQPPSGFRALSNVSPGSAFKVESHSYSHSQSQPQHASFSHGINIGSSPDGGGGGPSSGEPVKKKRGRPRKYGPDGSVSLMLSPMSATASSTPGSGTSSEKRPRGRPPGSGRKQQLATLGEWMNSSAGLAFSPHVITVGVDEDIVAKLLSFARQRPRAVCILTGTGTISSVTLRQPASTSIGVTYEGRFQILCLSGSYLVAEEGGPHNRTGGMSVSLSSPDGHIIGGGVTRLVASSPVQVVACSFVYGGSKPKTKQVTTTTTEDTSSEPQSSDKLASPGSVPPPNQNYTSSPAPGIWPASSRPVEVKSAHAHTGIDLTRG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo