SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g42230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g42230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g42230

Feature Type:gene_model
Chromosome:Gm01
Start:53534536
stop:53536750
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45430AT Annotation by Michelle Graham. TAIR10: AT-hook motif nuclear-localized protein 22 | chr2:18727848-18728801 FORWARD LENGTH=317 SoyBaseE_val: 3.00E-81ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009647GO-bp Annotation by Michelle Graham. GO Biological Process: skotomorphogenesis SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010359GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003680GO-mf Annotation by Michelle Graham. GO Molecular Function: AT DNA binding SoyBaseN/AISS
PF03479PFAM Domain of unknown function (DUF296) JGI ISS
UniRef100_B9RBV3UniRef Annotation by Michelle Graham. Most informative UniRef hit: ESC, putative n=1 Tax=Ricinus communis RepID=B9RBV3_RICCO SoyBaseE_val: 4.00E-116ISS
UniRef100_I1J9Z9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J9Z9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g42230 not represented in the dataset

Glyma01g42230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g03130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g213100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g42230.1   sequence type=CDS   gene model=Glyma01g42230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCTATTACAGCACACGGTCATTCTCTTCCCCCTCCTTTCCACGCAGGAAGAGATCTCCACCTCCACCAGCAACAACACCAGTTCCACTCCTTACAAGAAGACGAGCAGAGCGGAAGCAGCGGAGGCCTAAACCTCGCACACAAAAGGGAACACGAAGAAAACAACAACAACAACAGCAGCGATGGCAAAGAAGGTGGAGGTGCTGGCTCCGGCGAAACCGAAATTTCAAGAAGACCTCGCGGAAGACCCGCCGGATCCAAGAACAAGCCCAAACCCCCCATCATCATCACGCGCGACAGCGCCAACGCCCTCAAAACCCACGTCATGGAAGTCGCCGACGGCTGCGACATCGTCGATAGCGTCTCCGCCTTCGCCCGCCGCCGCCAGAGAGGGGTTTGCATCATGAGCGGCACCGGAACGGTCACCAACGTCACCCTGAGGCAACCGGCTTCTTCCGGCGCCGTCGTCACTCTCCACGGAAGGTTCGAGATCTTGTCCCTCGCCGGGTCCTTCCTGCCCCCTCCTGCGCCGCCTGCAGCCTCCGGTTTGACCATATACCTCGCCGGAGGACAAGGCCAAGTCGTCGGAGGAAGCGTGGTTGGCGCACTAATCGCTTCGGGGCCCGTGGTTATCATGTCAGCTTCGTTTAGCAACGCTGCGTATGAGAGGCTTCCTTTGGAAGATGAAGACCCTTCGATGGCGCTTCAGGGAGGTGGTTCGATTGGGTCACCGGGAGGTGGCGGTGGAGGTGGCGGTGGCGTTGGTCAACAGCAGCCATCTCAGCAGCTTATGGGGGATTCCACTGCGCCTCTTTTCCATGGTTTGAATCCCAATCTTCTGAATTCGGTTCAGATGCCGTCCGAGACTTTCTGGGCAACGGGTCGCTCTCCATACTGA

>Glyma01g42230.1   sequence type=predicted peptide   gene model=Glyma01g42230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPITAHGHSLPPPFHAGRDLHLHQQQHQFHSLQEDEQSGSSGGLNLAHKREHEENNNNNSSDGKEGGGAGSGETEISRRPRGRPAGSKNKPKPPIIITRDSANALKTHVMEVADGCDIVDSVSAFARRRQRGVCIMSGTGTVTNVTLRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPAASGLTIYLAGGQGQVVGGSVVGALIASGPVVIMSASFSNAAYERLPLEDEDPSMALQGGGSIGSPGGGGGGGGGVGQQQPSQQLMGDSTAPLFHGLNPNLLNSVQMPSETFWATGRSPY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo