Glyma01g42190 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g42190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g42190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g42190

Feature Type:	gene_model
Chromosome:	Gm01
Start:	53492596
stop:	53495233
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g42190

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G12390	AT	Annotation by Michelle Graham. TAIR10: Cornichon family protein \| chr1:4220347-4221481 FORWARD LENGTH=137	SoyBase	E_val: 2.00E-65	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG2729	KOG	ER vesicle integral membrane protein involved in establishing cell polarity, signaling and protein degradation	JGI		ISS
PTHR12290	Panther	CORNICHON	JGI		ISS
PTHR12290:SF5	Panther	CORNICHON-RELATED	JGI		ISS
PF03311	PFAM	Cornichon protein	JGI		ISS
UniRef100_B7FJU3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ER-derived vesicles protein ERV14 n=1 Tax=Medicago truncatula RepID=B7FJU3_MEDTR	SoyBase	E_val: 2.00E-70	ISS
UniRef100_UPI000189CFC0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189CFC0 related cluster n=1 Tax=unknown RepID=UPI000189CFC0	SoyBase	E_val: 1.00E-89	ISS

Expression Patterns of Glyma01g42190

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g42190 not represented in the dataset	Glyma01g42190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g42190

Paralog	Evidence	Comments
Glyma11g03180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g42190 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g212700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g42190

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g42190

Limit To All Plant Sequences

>Glyma01g42190.1   sequence type=CDS   gene model=Glyma01g42190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATCTATTTGCATGGCTTATCTCCTTCTTCCTCCTCATTGCCTTACTTGTCCTCGTTATGTACCAGCTAATGTGCCTGGCAGACCTAGAATTTGATTATATAAATCCTTATGACTCTTCAGCTCGAATAAATATGGTGGTTTTGCCAGAATATATTACGCAAGCTGTCCTGTGCTGCTTCTACCTTCTTACCGGGCATTGGATTATGGCACTCTTCTGTCTTCCTTATCTTTCTCTCAATCTCCGATTGTATAGGCAAGGAAGGCATTTGGTTGATGTTACTGAGATATTCAACCTGCTCTCTTGGGAAAAGAAGCAACGGCTCGTCAAACTCTTCTATCTTGTTTTCACCCTTTTCCTCTCTGTATTTTGGATGATTTACACATCATTGGATTAG

Predicted protein sequences of Glyma01g42190

Limit To All Plant Sequences

>Glyma01g42190.1   sequence type=predicted peptide   gene model=Glyma01g42190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADLFAWLISFFLLIALLVLVMYQLMCLADLEFDYINPYDSSARINMVVLPEYITQAVLCCFYLLTGHWIMALFCLPYLSLNLRLYRQGRHLVDVTEIFNLLSWEKKQRLVKLFYLVFTLFLSVFWMIYTSLD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain