SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g41527

Feature Type:gene_model
Chromosome:Gm01
Start:53004461
stop:53005302
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g41527
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47230AT Annotation by Michelle Graham. TAIR10: ethylene responsive element binding factor 5 | chr5:19180072-19180974 FORWARD LENGTH=300 SoyBaseE_val: 2.00E-48ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_D9IXB2UniRef Annotation by Michelle Graham. Most informative UniRef hit: ERF protein n=1 Tax=Glycine max RepID=D9IXB2_SOYBN SoyBaseE_val: 4.00E-65ISS
UniRef100_I1LGT2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LGT2_SOYBN SoyBaseE_val: 3.00E-116ISS

Expression Patterns of Glyma01g41527
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g41527 not represented in the dataset
Glyma01g41527 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g41527
ParalogEvidenceComments
Glyma11g03900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g41527 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g206700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g41527
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g41527
>Glyma01g41527.1   sequence type=CDS   gene model=Glyma01g41527   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAACTCTCTTGAAGTTTCTGCTCTCAATCGCATAAAACTGCATCTTCTAGGAGAACTCTCTCCCCTTCCACTCACAACCTCCTCTCAATCTAGCTCCATCTGTTCCCAATCTTCATGTTCTGACTCATCCGCCACACTTGACCAAATCTTCTCCGAATTCCTCTATTTCCCAACTTCTTCCTCAGAAAACCACTTTTCTGCATTGGAGTTTGAGGCAAAACCCGAAATAATTTACCTCGAAACCCCCAACCCACAATTGGAATTCACGTCTCTAACCACACAGGACAGTAAGAAACCTCAATCTAGTCGAAAGCCGTCGCTGCAAATCTCTCTCCCCAAGAAAACAGAGTGGATCCAATTCGGAGATCCCGAGTTTGCGGCGGAGATCCGGGACCCGAACAAGCGCGGCTCCAGGGTGTGGCTCGGGACGTTCGACACGGCTATCGAAGCCGCCAAAGCCTACGACCGAGCCGCGTTTAGGCTTCGCGGCTCCAAAGCCATCCTCAACTTCCCCCTCGAAGCCGGTGCCGATGACCGCAAACGCCAAAGGGAAGAGCAAGAGGAGGAGCCCGCGGTGGAAGTCGTCAAGAGGGTAAAAGTAGAGGAATCTGACGTTAGTCGTATTAAGGAGACTCCGTTAACGCCGTCTAGTTGGTTAGGGTTCTGGGGTGGTGATTCTAACGGAATCTTCACCGTGCCGCCCTTGTCACCGTTATCTCCCCACCCGGCGTTGGGTTTTCCACAGCTTATGGTTGTGTGA
Predicted protein sequences of Glyma01g41527
>Glyma01g41527.1   sequence type=predicted peptide   gene model=Glyma01g41527   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANSLEVSALNRIKLHLLGELSPLPLTTSSQSSSICSQSSCSDSSATLDQIFSEFLYFPTSSSENHFSALEFEAKPEIIYLETPNPQLEFTSLTTQDSKKPQSSRKPSLQISLPKKTEWIQFGDPEFAAEIRDPNKRGSRVWLGTFDTAIEAAKAYDRAAFRLRGSKAILNFPLEAGADDRKRQREEQEEEPAVEVVKRVKVEESDVSRIKETPLTPSSWLGFWGGDSNGIFTVPPLSPLSPHPALGFPQLMVV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo