SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g41330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g41330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g41330

Feature Type:gene_model
Chromosome:Gm01
Start:52863518
stop:52866247
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17030AT Annotation by Michelle Graham. TAIR10: expansin-like B1 | chr4:9581817-9583181 REVERSE LENGTH=250 SoyBaseE_val: 5.00E-110ISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009828GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall loosening SoyBaseN/AISS
GO:0019953GO-bp Annotation by Michelle Graham. GO Biological Process: sexual reproduction SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PF01357PFAM Pollen allergen JGI ISS
PF03330PFAM Rare lipoprotein A (RlpA)-like double-psi beta-barrel JGI ISS
UniRef100_B9SZ01UniRef Annotation by Michelle Graham. Most informative UniRef hit: Major pollen allergen Ory s 1, putative n=1 Tax=Ricinus communis RepID=B9SZ01_RICCO SoyBaseE_val: 1.00E-113ISS
UniRef100_I1J9Q9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1J9Q9_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
EXLB3 expansin-like B gene 3

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g41330 not represented in the dataset

Glyma01g41330 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g04080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g204800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g41330.1   sequence type=CDS   gene model=Glyma01g41330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTTAATTTTAAGTACCAACTTAGCCTTTTCTGTGTCACACTGCTCTTACCTGCCCTGTGTACCTCTCAAGACTCTTTTACGTGCTCCAGAGCAACCTATTATGGTAGCCCAGATTGTTATGGAAATCCAAGGGGAGCTTGTGGCTTTGGAGAATATGGAAAAACGGTAAACGATGGTAGTGTCGCAGGCGTGTCTTGGCTATGGAAGAATGGATCTGGCTGTGGAGCATGTTATCAGGTTAGGTGCAAAATACCACAATTCTGCGATGAGAATGGAGCATACGTGGTGGTTACAGATTATGGCGAGGGAGACAGAACAGACTTTATTATGAGTCCACGTGCCTACTCAAGATTGGGGAGAAATGCAGATGCATCTGCAGAACTATTCAAATACGGTGTGATGGATGTAGAATACAGAAGGGTACCCTGTAGATACGGTGGCTATAACCTCTTGGTTAAGGTCCATGAACACAGCAGAAACCCTCACTACTTAGCCATTGTCATTCTCTATCTTGGTGGAACTTACGACGTAACTGCTGTTGAATTGTGGCAGGAAGATTGCCAAGAGTGGAGGCGAATGCGCAGGGCATTTGGGACTGTGTTTGACGCTGAGAACCCTCCAAGGGGTGACATAAAGTTGAGGTTCCAATTGAGTGGTAATGCAGAGAAGTATTGGGTGCAATCCGAGAATGTTATCTCTAGTGATTGGGAGGGTGGAGCTGTCTTTGACTCCGAAATTCAGCTTGGTTAA

>Glyma01g41330.1   sequence type=predicted peptide   gene model=Glyma01g41330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELNFKYQLSLFCVTLLLPALCTSQDSFTCSRATYYGSPDCYGNPRGACGFGEYGKTVNDGSVAGVSWLWKNGSGCGACYQVRCKIPQFCDENGAYVVVTDYGEGDRTDFIMSPRAYSRLGRNADASAELFKYGVMDVEYRRVPCRYGGYNLLVKVHEHSRNPHYLAIVILYLGGTYDVTAVELWQEDCQEWRRMRRAFGTVFDAENPPRGDIKLRFQLSGNAEKYWVQSENVISSDWEGGAVFDSEIQLG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo