Glyma01g40455 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g40455

Feature Type:	gene_model
Chromosome:	Gm01
Start:	52206889
stop:	52208023
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g40455

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_E9L579	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CLE33 protein n=1 Tax=Glycine max RepID=E9L579_SOYBN	SoyBase	E_val: 4.00E-39	ISS
UniRef100_E9L579	UniRef	Annotation by Michelle Graham. Best UniRef hit: CLE33 protein n=1 Tax=Glycine max RepID=E9L579_SOYBN	SoyBase	E_val: 4.00E-39	ISS

Expression Patterns of Glyma01g40455

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g40455 not represented in the dataset	Glyma01g40455 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g40455

Paralog	Evidence	Comments
Glyma11g04831	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g40455 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g196700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g40455

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g40455

Limit To All Plant Sequences

>Glyma01g40455.1   sequence type=CDS   gene model=Glyma01g40455   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAAGGAGTGACATGAGTGCTCTTTCTGTGCTGCTGGTTCTACTGATATTCAGCAATTCTGGGATTCTTGGTATAGCTGGTGGTTTGTTCAATTTCACAAGGTATTCTATCCCACGTAAGAATATCTCTGGCAATGGCAAAGCAGAGTTACAAGACAAGAGAGGCGTGCCATCAGGAGCTAATCCTCTGCATAATCGGTAG

Predicted protein sequences of Glyma01g40455

Limit To All Plant Sequences

>Glyma01g40455.1   sequence type=predicted peptide   gene model=Glyma01g40455   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRSDMSALSVLLVLLIFSNSGILGIAGGLFNFTRYSIPRKNISGNGKAELQDKRGVPSGANPLHNR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain