Report for Sequence Feature Glyma01g39770
Feature Type: gene_model
Chromosome: Gm01
Start: 51633200
stop: 51634269
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma01g39770
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G15000 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G34265.2); Has 70 Blast hits to 70 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 70; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:6481200-6482316 REVERSE LENGTH=93
SoyBase E_val: 5.00E-13 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009220 GO-bp
Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1J9B2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J9B2_SOYBN
SoyBase E_val: 6.00E-53 ISS
Expression Patterns of Glyma01g39770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma01g39770
Paralog Evidence Comments
Glyma11g05517 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma01g39770 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.01g190500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma01g39770
Coding sequences of Glyma01g39770
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma01g39770.1 sequence type=CDS gene model=Glyma01g39770 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGTGGCGCTGCGGATCTCTCTCTCGGTCGGTGCTCTCGGCCGCGAGAACCATTCCAACTCGTTCCTCCATTTCTCCACTCTCGCCTTCCCTTCGCTCTCATCTTCTCCACTCTCGCCGCCCCCTCAATACACTCCCTAGGACTGTGGGAATTCTCGTGTGCACGCATTCGCTGATGCCTCTGCACAGCGCTGACGCCTCCGCTCGTCTCACTTCTCACATTTCCGTCGAATCGCGCGCTTGCTGCGAATTGTCTCAGGGTACTTGA
Predicted protein sequences of Glyma01g39770
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma01g39770.1 sequence type=predicted peptide gene model=Glyma01g39770 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAWRCGSLSRSVLSAARTIPTRSSISPLSPSLRSHLLHSRRPLNTLPRTVGILVCTHSLMPLHSADASARLTSHISVESRACCELSQGT*