Glyma01g39700 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g39700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g39700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g39700

Feature Type:	gene_model
Chromosome:	Gm01
Start:	51584480
stop:	51586969
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g39700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62290	AT	Annotation by Michelle Graham. TAIR10: ADP-ribosylation factor A1E \| chr3:23052287-23053545 FORWARD LENGTH=181	SoyBase	E_val: 4.00E-115	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
GO:0016004	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipase activator activity	SoyBase	N/A	ISS
KOG0070	KOG	GTP-binding ADP-ribosylation factor Arf1	JGI		ISS
PTHR11711	Panther	ARF-RELATED	JGI		ISS
PF00025	PFAM	ADP-ribosylation factor family	JGI		ISS
UniRef100_C6SX15	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX15_SOYBN	SoyBase	E_val: 1.00E-130	ISS
UniRef100_G7K590	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor n=1 Tax=Medicago truncatula RepID=G7K590_MEDTR	SoyBase	E_val: 2.00E-124	ISS

Expression Patterns of Glyma01g39700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g39700 not represented in the dataset	Glyma01g39700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g39700

Paralog	Evidence	Comments
Glyma11g05581	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g39700 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g189800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g39700

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma01g39700

Limit To All Plant Sequences

>Glyma01g39700.3   sequence type=transcript   gene model=Glyma01g39700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGTGTGAGAAAATCATAATTTCCTTTTTATTTTTTCATGAACAAATGTTAGTAGTTAATTGTTAATATTTTATAAAAAAAAAATACTTTTTTCTTCTATCTTTTTTTACTTTTATCACCAAATCAATCTTATAACCCTCTAATTCCCTTTTTATTGCCCATGTTTTCAAATGGCATGCCCATCAATCATTTTATTCTCTCAGCAATCAACATGTGAATCCTATTCTCACTTTCTATTAGTGCAGTATTGATGCCTGGTGTTATTTTCTGGTTACATGTACCAACAACAGATTCAGTTTTAAGTTTCCCCTGCTTCTCAACAAAAAAATTACATTTTTTCAGCTTAAATATTGGTTGAACCAGAGGCAACAATGGGTTTGACGGTGTCACGGCTATTGAGATTGTTTTATGCAAGGAAAGAAATGAGGATTCTGATGGTGGGTCTTGATGCTGCTGGGAAAACAACAATACTCTACAAACTGAAACTTGGAGAAATCGTCACTACAATACCCACAATAGGCTTCAATGTGGAGACTGTTGAGTACAAAAATGTCAGCTTCACCGTCTGGGATGTTGGAGGACAGGACAAGATTCGACCATTGTGGAGACACTACTTCCAGAATACACAAGGTCTTATCTTTGTGGTAGATAGTAACGATAGGGAAAGAATTTTAGAAGCCAGGGATGAGTTACATAGAATGTTGAGTGAGGATGAACTTCGTGACGCTACAGTATTGGTATTTGCCAATAAGCAAGATCTTCCAAATGCTTTAAGTGTTGCGGAAATTACAGATAAACTCGGTTTACATTCACTCCGCCTGCGTCGCTGGTACATCCAGCCAACTTGTGCTACGTCCGGCCAAGGACTCTATGAGGGGCTAGATTGGTTATCTAGTCACATAACTAACAAGACAAGATGAACCAAGCTCTGATTGCGTTTCTGATCTTCGATTGAATACTGAGACTGTTATATATATTATGTACAATATCTCGTTTGTTTATAGGCATAAATGAGTGGTATCTGTTATTTGAAGTTTGAACCATCTATAAAAATATCAATAACTATGATATAAGTATATAAACTCTGAGGAGTATTATGTACACGTTACACCCCGCTTTCAGTATTTAATAATATTAAGAGAAATGTTACCAGTATATTCTTTAACATGCTATTTTGAAC

Coding sequences of Glyma01g39700

Limit To All Plant Sequences

>Glyma01g39700.2   sequence type=CDS   gene model=Glyma01g39700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGACGGTGTCACGGCTATTGAGATTGTTTTATGCAAGGAAAGAAATGAGGATTCTGATGGTGGGTCTTGATGCTGCTGGGAAAACAACAATACTCTACAAACTGAAACTTGGAGAAATCGTCACTACAATACCCACAATAGGCTTCAATGTGGAGACTGTTGAGTACAAAAATGTCAGCTTCACCGTCTGGGATGTTGGAGGACAGGACAAGATTCGACCATTGTGGAGACACTACTTCCAGAATACACAAGGTCTTATCTTTGTGGTAGATAGTAACGATAGGGAAAGAATTTTAGAAGCCAGGGATGAGTTACATAGAATGTTGAGTGAGGATGAACTTCGTGACGCTACAGTATTGGTATTTGCCAATAAGCAAGATCTTCCAAATGCTTTAAGTGTTGCGGAAATTACAGATAAACTCGGTTTACATTCACTCCGCCTGCGTCGCTGGTACATCCAGCCAACTTGTGCTACGTCCGGCCAAGGACTCTATGAGGGGCTAGATTGGTTATCTAGTCACATAACTAACAAGACAAGATGA

>Glyma01g39700.3   sequence type=CDS   gene model=Glyma01g39700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGACGGTGTCACGGCTATTGAGATTGTTTTATGCAAGGAAAGAAATGAGGATTCTGATGGTGGGTCTTGATGCTGCTGGGAAAACAACAATACTCTACAAACTGAAACTTGGAGAAATCGTCACTACAATACCCACAATAGGCTTCAATGTGGAGACTGTTGAGTACAAAAATGTCAGCTTCACCGTCTGGGATGTTGGAGGACAGGACAAGATTCGACCATTGTGGAGACACTACTTCCAGAATACACAAGGTCTTATCTTTGTGGTAGATAGTAACGATAGGGAAAGAATTTTAGAAGCCAGGGATGAGTTACATAGAATGTTGAGTGAGGATGAACTTCGTGACGCTACAGTATTGGTATTTGCCAATAAGCAAGATCTTCCAAATGCTTTAAGTGTTGCGGAAATTACAGATAAACTCGGTTTACATTCACTCCGCCTGCGTCGCTGGTACATCCAGCCAACTTGTGCTACGTCCGGCCAAGGACTCTATGAGGGGCTAGATTGGTTATCTAGTCACATAACTAACAAGACAAGATGA

Predicted protein sequences of Glyma01g39700

Limit To All Plant Sequences

>Glyma01g39700.2   sequence type=predicted peptide   gene model=Glyma01g39700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLTVSRLLRLFYARKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERILEARDELHRMLSEDELRDATVLVFANKQDLPNALSVAEITDKLGLHSLRLRRWYIQPTCATSGQGLYEGLDWLSSHITNKTR*

>Glyma01g39700.3   sequence type=predicted peptide   gene model=Glyma01g39700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLTVSRLLRLFYARKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERILEARDELHRMLSEDELRDATVLVFANKQDLPNALSVAEITDKLGLHSLRLRRWYIQPTCATSGQGLYEGLDWLSSHITNKTR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain