SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g39580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g39580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g39580

Feature Type:gene_model
Chromosome:Gm01
Start:51518039
stop:51522362
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57870AT Annotation by Michelle Graham. TAIR10: sumo conjugation enzyme 1 | chr3:21428831-21430110 REVERSE LENGTH=160 SoyBaseE_val: 2.00E-106ISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
GO:0019789GO-mf Annotation by Michelle Graham. GO Molecular Function: SUMO ligase activity SoyBaseN/AISS
KOG0424 KOG Ubiquitin-protein ligase JGI ISS
PTHR24067Panther UBIQUITIN-CONJUGATING ENZYME E2 JGI ISS
PTHR24067:SF32Panther UBIQUITIN-CONJUGATING ENZYME E2D 2 JGI ISS
PF00179PFAM Ubiquitin-conjugating enzyme JGI ISS
UniRef100_E6NU89UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL03K20.8 protein n=1 Tax=Jatropha curcas RepID=E6NU89_9ROSI SoyBaseE_val: 6.00E-111ISS
UniRef100_I1J996UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J996_SOYBN SoyBaseE_val: 8.00E-116ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g39580 not represented in the dataset

Glyma01g39580 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g05670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g188900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g39580.1   sequence type=CDS   gene model=Glyma01g39580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGTATCGCCCGTGGACGTCTTGCCGAGGAGCGAAAGTCATGGCGCAAAAACCACCCTCATGGTTTCGTTGCCAAGCCCGAGACTCTCCCTGATGCCACCGTTAATTTGATGGTCTGGCATTGCACTATTCCTGGCAAGGCTGGGACTGATTGGGAGGGTGGATATTTCCCACTGACAATGCACTTCAGTGAAGATTACCCTAGCAAGCCTCCCAAGTGCAAATTCCCTCAAGGTTTCTTTCACCCCAATGTGTATCCATCTGGAACTGTTTGCTTGTCTATACTTAATGAAGATAGTGGATGGAGACCAGCTATAACAGTGAAGCAAATTCTTGTGGGCATCCAGGACCTGCTTGATCAACCAAATCCTGCTGACCCTGCCCAGACTGAGGGTTATCATCTATTCATCCAGGATGCGGCTGAGTACAAGAGAAGGGTCCGACAGCAGTCAAAGCAATATCCACCTCTTGTCTAG

>Glyma01g39580.1   sequence type=predicted peptide   gene model=Glyma01g39580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGIARGRLAEERKSWRKNHPHGFVAKPETLPDATVNLMVWHCTIPGKAGTDWEGGYFPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQSKQYPPLV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo