SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g39260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g39260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g39260

Feature Type:gene_model
Chromosome:Gm01
Start:51227463
stop:51229777
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G36990AT Annotation by Michelle Graham. TAIR10: heat shock factor 4 | chr4:17440660-17441706 FORWARD LENGTH=284 SoyBaseE_val: 4.00E-80ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006984GO-bp Annotation by Michelle Graham. GO Biological Process: ER-nucleus signaling pathway SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR10015Panther HEAT SHOCK TRANSCRIPTION FACTOR JGI ISS
PTHR10015:SF7Panther HEAT SHOCK TRANSCRIPTION FACTOR JGI ISS
PF00447PFAM HSF-type DNA-binding JGI ISS
UniRef100_Q43457UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock transcription factor 34 n=1 Tax=Glycine max RepID=Q43457_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q43457UniRef Annotation by Michelle Graham. Best UniRef hit: Heat shock transcription factor 34 n=1 Tax=Glycine max RepID=Q43457_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g39260 not represented in the dataset

Glyma01g39260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g06010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g185800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g39260.1   sequence type=CDS   gene model=Glyma01g39260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCAACGATCGGTGCCGGCGCCGTTCTTGACGAAGACGTATCAGTTGGTGGAGGATCAGGGGACGGACCAGGTGATATCGTGGGGTGAAAGTGGGAACACTTTTGTGGTGTGGAAGCATGCGGATTTTGCAAAGGATTTGCTTCCAAAATATTTCAAGCACAACAACTTCTCCAGCTTTGTTCGACAGCTCAATACCTATGGATTCCGAAAAATTGTGCCAGACAAATGGGAATTCGCGAACGAGCATTTCAAGCGAGGGCAGAAGGAGCTTCTCTCCGAGATCAAACGCCGCAAGACCGTGCCTCAATCGTCGGCACATCCCCCGGAGGCCGGAAAGTCCGGCGGCGACGGCAACTCTCCGTTGAACTCCGGCAGCGACGACGCGGGCTCCACCTCAACCTCGTCCTCGTCCTCCGGTTCCAAGAACCAGGGATCGGTGGAAACAAACACAACGCCTTCTCACCAGTTATCGAGCGAGAACGAGAAACTGAAGAAGGATAACGAAACGCTGAGTTGCGAGCTGGCACGTGCGAGGAAGCAGTGCGATGAGCTCGTGGCTTTCCTCAGGGACCGTCTGATGGTGGGTCCCGATCAGATCGATCGCATCATGCGGCAAGGAAGTTGCGGATCTGAAAACGTGGTAGGTGAAGGCGGTGGAGGAGACTGTTTGAAACTGTTTGGTGTTTGGTTAAAAGGGGATACGCTAACAGACAAAAGAAACAACCACAAAAGAGGCCGCGAAGACCAAATGGGCTTCGGTGGGCCTCGCCTCAAGGAGTCAAAGCCCGTTGTTGACTTTGGAGCTGTAAATATCATGATGAAGAGCAACAGGGTTTGCAACTGA

>Glyma01g39260.1   sequence type=predicted peptide   gene model=Glyma01g39260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQRSVPAPFLTKTYQLVEDQGTDQVISWGESGNTFVVWKHADFAKDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDKWEFANEHFKRGQKELLSEIKRRKTVPQSSAHPPEAGKSGGDGNSPLNSGSDDAGSTSTSSSSSGSKNQGSVETNTTPSHQLSSENEKLKKDNETLSCELARARKQCDELVAFLRDRLMVGPDQIDRIMRQGSCGSENVVGEGGGGDCLKLFGVWLKGDTLTDKRNNHKRGREDQMGFGGPRLKESKPVVDFGAVNIMMKSNRVCN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo