SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g38950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g38950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g38950

Feature Type:gene_model
Chromosome:Gm01
Start:50927364
stop:50936118
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G23610AT Annotation by Michelle Graham. TAIR10: methyl esterase 3 | chr2:10044410-10046403 REVERSE LENGTH=263 SoyBaseE_val: 8.00E-31ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0080030GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl indole-3-acetate esterase activity SoyBaseN/AISS
GO:0080032GO-mf Annotation by Michelle Graham. GO Molecular Function: methyl jasmonate esterase activity SoyBaseN/AISS
PTHR10992Panther ALPHA/BETA HYDROLASE RELATED JGI ISS
PTHR10992:SF56Panther gb def: abhydrolase, alpha/beta hydrolase fold [bacillus anthracis a2012] JGI ISS
PF00561PFAM alpha/beta hydrolase fold JGI ISS
UniRef100_G7K9E1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methyl jasmonate esterase n=1 Tax=Medicago truncatula RepID=G7K9E1_MEDTR SoyBaseE_val: 4.00E-66ISS
UniRef100_I1J935UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J935_SOYBN SoyBaseE_val: 4.00E-108ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g38950 not represented in the dataset

Glyma01g38950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g06320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g182700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g38950.2   sequence type=CDS   gene model=Glyma01g38950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTTCTGCTGTCTTTGGCAGAAGAAGAGCAAGTAATCCTTGTGGGTCATAGCTTTGGTGGTCTATGCATATCTGTAGCCATGGAATTGTTCCCTACCAAGATTGCAGCTGCAGTATTTGTTTCCGCTTGGCTGCCTTCTCCCGACCTAAACTATTTGGATCTCCTCCAAGAGGACTTGACCCTGGCATTGTCACTATTGAGACCCTTTCCTATCTTTGGTGATGAAGATTTGCAAGAGAATACACAACTCACAAGAGACAACTACGGAATTGTTGCCAAAGTCTATATAGTGTGTGAACAAGATAAATTGTTTAAGCATGATTTCCAACTGTTTATGATTGAACGAAACCCTCCTAACGATGTCAAAGTGATTGCTGGTGCTGATCACATGTCCATGTTCTCTAAACCGCAAGAGCTTTTCTCTTACCTTCAAGAGATAACCGACACCTATTACTAA

>Glyma01g38950.2   sequence type=predicted peptide   gene model=Glyma01g38950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFLLSLAEEEQVILVGHSFGGLCISVAMELFPTKIAAAVFVSAWLPSPDLNYLDLLQEDLTLALSLLRPFPIFGDEDLQENTQLTRDNYGIVAKVYIVCEQDKLFKHDFQLFMIERNPPNDVKVIAGADHMSMFSKPQELFSYLQEITDTYY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo