Glyma01g37200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g37200

Feature Type:	gene_model
Chromosome:	Gm01
Start:	49597449
stop:	49598567
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g37200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_I1J8M1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J8M1_SOYBN	SoyBase	E_val: 1.00E-59	ISS
UniRef100_Q33AI9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=3 Tax=Oryza sativa Japonica Group RepID=Q33AI9_ORYSJ	SoyBase	E_val: 5.00E-10	ISS

Expression Patterns of Glyma01g37200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g37200

Paralog	Evidence	Comments
Glyma11g08080	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g37200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g166900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g37200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g37200

Limit To All Plant Sequences

>Glyma01g37200.1   sequence type=CDS   gene model=Glyma01g37200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAAGGGTCAATGCATGCCCCGGTTGAAAAGCAGCTCTTGCAAGAACAAAACACCATCTCCAATGACCTTATTAGAGCGTTTCAGAGAAGCAGTGCTCCGCTTAATGATGCTATCTGCACTTTCTAAGGCCACAAGCCACCGTGGCTCCGGCGACGGGGAACGACAAAATCGACGTTATAATAGCCCTTATGATCCACACCACGGTGAAGCCGTAGCAGATTGCATCGAGTTCATTAAGAAAAAGGCTGCTACCGACACCGGTTAA

Predicted protein sequences of Glyma01g37200

Limit To All Plant Sequences

>Glyma01g37200.1   sequence type=predicted peptide   gene model=Glyma01g37200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMKGQCMPRLKSSSCKNKTPSPMTLLERFREAVLRLMMLSALSKATSHRGSGDGERQNRRYNSPYDPHHGEAVADCIEFIKKKAATDTG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain