SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g37051): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g37051): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g37051

Feature Type:gene_model
Chromosome:Gm01
Start:49432479
stop:49435070
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g37051
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66190AT Annotation by Michelle Graham. TAIR10: ferredoxin-NADP(+)-oxidoreductase 1 | chr5:26451203-26452616 REVERSE LENGTH=262 SoyBaseE_val: 2.00E-40ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009767GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003959GO-mf Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity SoyBaseN/AISS
GO:0004324GO-mf Annotation by Michelle Graham. GO Molecular Function: ferredoxin-NADP+ reductase activity SoyBaseN/AISS
GO:0008266GO-mf Annotation by Michelle Graham. GO Molecular Function: poly(U) RNA binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0045156GO-mf Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity SoyBaseN/AISS
GO:0045157GO-mf Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons within the noncyclic electron transport pathway of photosynthesis activity SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
GO:0050661GO-mf Annotation by Michelle Graham. GO Molecular Function: NADP binding SoyBaseN/AISS
PTHR19384Panther NADPH FLAVIN OXIDOREDUCTASE JGI ISS
PTHR19384:SF1Panther FERREDOXIN--NADP REDUCTASE JGI ISS
PF00175PFAM Oxidoreductase NAD-binding domain JGI ISS
UniRef100_B9T6D1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin--NADP reductase, putative n=1 Tax=Ricinus communis RepID=B9T6D1_RICCO SoyBaseE_val: 2.00E-38ISS
UniRef100_UPI0002336E6AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336E6A related cluster n=1 Tax=unknown RepID=UPI0002336E6A SoyBaseE_val: 5.00E-39ISS

Expression Patterns of Glyma01g37051
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g37051 not represented in the dataset
Glyma01g37051 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g37051
ParalogEvidenceComments
Glyma11g08230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g37051 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g165700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g37051
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma01g37051
>Glyma01g37051.2   sequence type=transcript   gene model=Glyma01g37051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGAAAAAAAAGGACCTTGTTATCACAATTTGCTTACAGAAAATAAAAAATGTTCTATGATTCATAGGAAGGATCCTCTCCAACCAATTTACAGAAAAAGGGTTATGTGATATGAAGCTTGGACACCTCAGTTTCTTGCTGGGTCTGGATGTTCGACACGAACTCGACATCGACGCCGGTACGACGCCCGTACGACACGCATCAGATACACCCCACCGGTGTCTATATTGAAAAACCATTCTTTCCAGCTCCAACACGGTTGTCTGTCATACACTACAATTACAAATAAACTTATTCACACATCTGCTACTGCATTGGCTTATACATATGCTGGTATGTGGAACAAGAATTTGAAAAGATGAAGGATAAAGTACCTGATAACTTCATGCTTGACTTTGCTGTGAGCAGAGAGCAAACAAACGAAAAAGGAGAGAAAATGTACATCCAAACACGAATGGCTCAATATGCAGAAGAGCTATGGGAGTTACTGAAGAAAGATAACACTTTTGTCTATATGTGTGGACTGAAAGGAATGGAAAAGGTATCGATTGGATTGAGTACAAGAGGCAATTGAAGAAGGCAGAACAACGGAATGTCG
Coding sequences of Glyma01g37051
>Glyma01g37051.1   sequence type=CDS   gene model=Glyma01g37051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGATAAAGTACCTGATAACTTCATGCTTGACTTTGCTGTGAGCAGAGAGCAAACAAACGAAAAAGGAGAGAAAATGTACATCCAAACACGAATGGCTCAATATGCAGAAGAGCTATGGGAGTTACTGAAGAAAGATAACACTTTTGTCTATATGTGTGGACTGAAAGGAATGGAAAAGGTAATCAATGACATAATGGTGTTATTGGCTGCAAAAGATGGTAACAACACTTATCTTTAG

>Glyma01g37051.2   sequence type=CDS   gene model=Glyma01g37051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGATAAAGTACCTGATAACTTCATGCTTGACTTTGCTGTGAGCAGAGAGCAAACAAACGAAAAAGGAGAGAAAATGTACATCCAAACACGAATGGCTCAATATGCAGAAGAGCTATGGGAGTTACTGAAGAAAGATAACACTTTTGTCTATATGTGTGGACTGAAAGGAATGGAAAAGGTATCGATTGGATTGAGTACAAGAGGCAATTGA
Predicted protein sequences of Glyma01g37051
>Glyma01g37051.1   sequence type=predicted peptide   gene model=Glyma01g37051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDKVPDNFMLDFAVSREQTNEKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKVINDIMVLLAAKDGNNTYL*

>Glyma01g37051.2   sequence type=predicted peptide   gene model=Glyma01g37051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDKVPDNFMLDFAVSREQTNEKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKVSIGLSTRGN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo