SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g36940

Feature Type:gene_model
Chromosome:Gm01
Start:49334743
stop:49338803
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g36940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35000AT Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 3 | chr4:16665007-16667541 REVERSE LENGTH=287 SoyBaseE_val: 2.00E-98ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005778GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisomal membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0016688GO-mf Annotation by Michelle Graham. GO Molecular Function: L-ascorbate peroxidase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00141PFAM Peroxidase JGI ISS
UniRef100_G7JXJ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ascorbate peroxidase n=1 Tax=Medicago truncatula RepID=G7JXJ2_MEDTR SoyBaseE_val: 2.00E-109ISS
UniRef100_I1J8J7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J8J7_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma01g36940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g36940
ParalogEvidenceComments
Glyma11g08320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g36940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g164700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g36940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g36940
>Glyma01g36940.1   sequence type=CDS   gene model=Glyma01g36940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAACCTGTTGTTGACGACGAATATCTCAAGGAAATAGACAAGGCTCGACGTGAACTTCGCGCTTTCATCACCAGCAACCAATGCGCTCCTCTCATGCTTCGATTAGCGTGGAACGATGCTGCCACCTACGATGCCAGAAACAGAGCAGGAGGCCCCAACGGTTCTATCAGGACTGATAAAGAGTTGAAACACGAAGCAAACGAGGGATTGTTAAAAGCAACTCAATTATGTGAGCATGTGAAGGCCAAACTTAAAAAAGTTTCATACGCAGACCTTTACCAGCTAGCTGGTGTTGTTGCAATAGAGGTCTCTGGGGGTCCAACTATTGAATTTTTGCCTGGGAGAAAAGATTCAATGGAATCTTCAGCAGAAGGGCTTCTTCCAGATGTCAAACAAGGTGCATCGATTATAAGGAATATATTTTCTCGTATGGGTATAAGTGATGATAAACACATCGTTGCCCTATGTGGAGGCCTCACTTGGGGGGAAACACTTAAAGATCGTTCTGACTCTAAAGGTCAATGGCCAAAGGACCCTTTGAAGTTTGATAACTCCTATTATAAGAAAATATTGAGTAAGGATTTATCATCTAGGCTTCCCATAGAAGATGCTTTACTAACCGATCAAAGCTTCCGCCGCCATGTTGAAGAGTATTCAAAGGATGAGAATAGTTTCTTCAAAGAATATGCAATGTCACATAAGAAACTCTCAGAACTAGGCTACAATCTCAAGAAGCAAAATCAATCAAAGGTACCAGATGAGGAGCAAAATCAGCCCAAGGGACCATATGAGAAGCTAAATCAGCACAGGGGACTTATAGGAATCGGTATAGTATCCGTGGTGACCGTGATATTAGGTTACTTACTCAAGAGGAAGAAAAACCAGTTGAAGAAATGA
Predicted protein sequences of Glyma01g36940
>Glyma01g36940.1   sequence type=predicted peptide   gene model=Glyma01g36940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEPVVDDEYLKEIDKARRELRAFITSNQCAPLMLRLAWNDAATYDARNRAGGPNGSIRTDKELKHEANEGLLKATQLCEHVKAKLKKVSYADLYQLAGVVAIEVSGGPTIEFLPGRKDSMESSAEGLLPDVKQGASIIRNIFSRMGISDDKHIVALCGGLTWGETLKDRSDSKGQWPKDPLKFDNSYYKKILSKDLSSRLPIEDALLTDQSFRRHVEEYSKDENSFFKEYAMSHKKLSELGYNLKKQNQSKVPDEEQNQPKGPYEKLNQHRGLIGIGIVSVVTVILGYLLKRKKNQLKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo