|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G59570 | AT | Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr5:24004047-24004943 FORWARD LENGTH=298 | SoyBase | E_val: 8.00E-23 | ISS |
GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
GO:0007623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: circadian rhythm | SoyBase | N/A | ISS |
GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
PF00249 | PFAM | Myb-like DNA-binding domain | JGI | ISS | |
UniRef100_G7JCG7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Two-component response regulator ARR1 n=1 Tax=Medicago truncatula RepID=G7JCG7_MEDTR | SoyBase | E_val: 7.00E-24 | ISS |
UniRef100_I1J8G8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J8G8_SOYBN | SoyBase | E_val: 8.00E-84 | ISS |
Glyma01g36730 not represented in the dataset |
Glyma01g36730 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.01g162600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g36730.1 sequence type=CDS gene model=Glyma01g36730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCACTAGAGCCCCACCGAATTGTCCTCAACGTCAAACGCGGCTCGTGCAACACGCTCTCCACAATCCGCAGTGACAGGACCATGCAGCATGCCTTCTTCTCCAACAACAACAACAACCAGCACTACAATGGCGATGGAGACGTCAACGACAAGGAAGACAACGATGACACCGATTGCAAAGACTCGAGGTCGGATTCTCGAACGGAGACCTCAGCGAAGCGAACGACAGTGAAGCGACTGCAACTAGTGTGGACCCTGCAGCTTCACAAGAGGTTCGTGGACGTGGTGGCGCACCTCGGGATCAAAAACGCAGTGCCGAAGACGATTATGCAATTGATGAACGTGGAAGGGTTGTCCCTATAA
>Glyma01g36730.1 sequence type=predicted peptide gene model=Glyma01g36730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSLEPHRIVLNVKRGSCNTLSTIRSDRTMQHAFFSNNNNNQHYNGDGDVNDKEDNDDTDCKDSRSDSRTETSAKRTTVKRLQLVWTLQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLSL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||