SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g36250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g36250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g36250

Feature Type:gene_model
Chromosome:Gm01
Start:48740117
stop:48740919
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38250AT Annotation by Michelle Graham. TAIR10: Transmembrane amino acid transporter family protein | chr4:17935533-17936843 FORWARD LENGTH=436 SoyBaseE_val: 2.00E-53ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0010193GO-bp Annotation by Michelle Graham. GO Biological Process: response to ozone SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
PTHR22950Panther AMINO ACID TRANSPORTER JGI ISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_G7K191UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proton-coupled amino acid transporter n=1 Tax=Medicago truncatula RepID=G7K191_MEDTR SoyBaseE_val: 2.00E-67ISS
UniRef100_UPI00023373BEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023373BE related cluster n=1 Tax=unknown RepID=UPI00023373BE SoyBaseE_val: 3.00E-137ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g36250 not represented in the dataset

Glyma01g36250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g09192 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g36250.2   sequence type=CDS   gene model=Glyma01g36250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTCAAGCTCATGGGCCTCCTCATGCTCTTCGCCATCGCCTTCCACACCCGCCGCAAACGAGAATCTCTCTCCTCCTCGCTGCCAAGAGTATCGTGATGGTCGAGGATGTTTTTGTTTTTGTTAAGAACAAGCCCGATTTGAAAATATTCGGGGGTTTATCGGTGTTCTTCTACGGCATAGGTGTGGCTGTGTATGCTTTCGAGGGAATTGGAATGGTTTTGCCTTTGGAAACTGAGGCGAAGGACAAGAAGAATTTCGGGTACTTAGCGTTTGGGGAAGAAACTAAGGATATTATTACCACCAATTTGGGGCCTGGGGTGATTAGTGTATTGGTTCAGTTGGGGCTTTGTGTTAATCTCTTCTTCACTTTTCCGATTATGATGAACCCGGTGAATGAGGTGAATGTGTATGTTGTTCTGAGTTTTGTGCTGCCTGCGATGTTTCATTGTATGGTTTTTAGGGAGGAGTTGGGGTGGAGGTGTGTTCTTTGGGATGGGGCAATTGCGGTTTTTGGGTTTGTGATTGCTGTCACTGGGACTTTCACTTCTGTGATGGAGAGATTTTTTGGCCTACCCCTACATCATGATTCAGCACAAAACAACTTGTTTGGGGATAACCATTTTGGATGCTGA

>Glyma01g36250.2   sequence type=predicted peptide   gene model=Glyma01g36250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LQAHGPPHALRHRLPHPPQTRISLLLAAKSIVMVEDVFVFVKNKPDLKIFGGLSVFFYGIGVAVYAFEGIGMVLPLETEAKDKKNFGYLAFGEETKDIITTNLGPGVISVLVQLGLCVNLFFTFPIMMNPVNEVNVYVVLSFVLPAMFHCMVFREELGWRCVLWDGAIAVFGFVIAVTGTFTSVMERFFGLPLHHDSAQNNLFGDNHFGC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo