SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g36070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g36070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g36070

Feature Type:gene_model
Chromosome:Gm01
Start:48524088
stop:48529043
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17420AT Annotation by Michelle Graham. TAIR10: NADPH-dependent thioredoxin reductase A | chr2:7564357-7566219 FORWARD LENGTH=378 SoyBaseE_val: 0ISS
GO:0009846GO-bp Annotation by Michelle Graham. GO Biological Process: pollen germination SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0019430GO-bp Annotation by Michelle Graham. GO Biological Process: removal of superoxide radicals SoyBaseN/AISS
GO:0042964GO-bp Annotation by Michelle Graham. GO Biological Process: thioredoxin biosynthetic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005759GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004791GO-mf Annotation by Michelle Graham. GO Molecular Function: thioredoxin-disulfide reductase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
KOG0404 KOG Thioredoxin reductase JGI ISS
PTHR22912Panther DISULFIDE OXIDOREDUCTASE JGI ISS
PTHR22912:SF51Panther SUBFAMILY NOT NAMED JGI ISS
PF00070PFAM Pyridine nucleotide-disulphide oxidoreductase JGI ISS
PF07992PFAM Pyridine nucleotide-disulphide oxidoreductase JGI ISS
UniRef100_I1J8A4UniRef Annotation by Michelle Graham. Best UniRef hit: Thioredoxin reductase n=2 Tax=Glycine max RepID=I1J8A4_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1J8A4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin reductase n=2 Tax=Glycine max RepID=I1J8A4_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g36070 not represented in the dataset

Glyma01g36070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g09350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g156600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g36070.1   sequence type=CDS   gene model=Glyma01g36070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATTTAGAATCTGCCCTAATCATCATAACTGGAAGAACCTCTTATCGAAGGCGCGAAACTTGATCAGTGTTGGACGCGCTTCATCCGCCGCCTTCGCCAACGCCATGGGTGACGTTCAGATCCACAAGACCAAACTCTGCATCATCGGAAGCGGCCCCGCCGCCCATACCGCCGCCGTCTACGCCGCCCGTGCAGAGCTGAAGCCTATCCTCTTCGAGGGCTGGATGGCCAACGACATCGCCCCCGGCGGCCAGCTCACCACCACCACTGACGTCGAGAACTTCCCCGGCTTCCCCGACGGCATCCTCGGCGGCGAGCTCATGGACCGCTGCCGGAGCCAGTCCCTCCGCTTCGGCACCGAGATCCACACCGAGACCGTCTCCAAGGTCGATTTCTCCGCCCGTCCTTTTAGGGTTTTCACCGATTCCCGCACCGTCGAGGCCGAATCCGTCATCGTCGCCACCGGCGCCGTTGCCAAGCGCCTCCCCTTCCCCGGCTCCGGCGATGGCCCCGATGGCTACTGGAACCGCGGCATCTCCGCGTGCGCCGTCTGCGATGGCGCCGCGCCGATCTTCCGGAACAAGCCACTGGCGGTGATCGGCGGCGGGGACTCGGCGATGGAGGAGGCCACCTTCCTCACCAAGTACGGTTCCGAGGTTTACATAATTCACCGCAGGGATACATTCAGGGCTTCGAAGATTATGCAGAGCAAGGTTATGGGCAATAGCAAGATTAAGGTGATTTGGAATTCGGTGGTGGTTGAGGCTTTTGGGGGCGGAGATAACAAGAGGGTGCTTGGGGGATTGAAGGTGAAGAATGTGGTGACTCGAGAGGTATCTGAATTGAAGGTTTCTGGGTTGTTTTTCGCAATTGGGCACGAGCCCGCAACCAAGTTCTTGGACGGGCAGCTTGAATTGGATTCTGATGGATATATAGTGACGAAGCCGGGGACGACGAAGACCAGTGTTGAGGGAGTGTTTGCTGCTGGGGATGTTCAGGACAAGAAGTATAGGCAAGCTATTACTGCTGCTGGCACTGGATGCATGGCAGCTTTGGATGCAGAACATTACCTACAAAATGTTGGTTTACAACAAGATAAGAGTGATTGA

>Glyma01g36070.1   sequence type=predicted peptide   gene model=Glyma01g36070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFRICPNHHNWKNLLSKARNLISVGRASSAAFANAMGDVQIHKTKLCIIGSGPAAHTAAVYAARAELKPILFEGWMANDIAPGGQLTTTTDVENFPGFPDGILGGELMDRCRSQSLRFGTEIHTETVSKVDFSARPFRVFTDSRTVEAESVIVATGAVAKRLPFPGSGDGPDGYWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEATFLTKYGSEVYIIHRRDTFRASKIMQSKVMGNSKIKVIWNSVVVEAFGGGDNKRVLGGLKVKNVVTREVSELKVSGLFFAIGHEPATKFLDGQLELDSDGYIVTKPGTTKTSVEGVFAAGDVQDKKYRQAITAAGTGCMAALDAEHYLQNVGLQQDKSD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo