SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g35315): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g35315): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g35315

Feature Type:gene_model
Chromosome:Gm01
Start:47840274
stop:47842107
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_G7K6T5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7K6T5_MEDTR SoyBaseE_val: 1.00E-73ISS
UniRef100_Q6Z9U4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Kinesin-like n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z9U4_ORYSJ SoyBaseE_val: 2.00E-34ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g35315 not represented in the dataset

Glyma01g35315 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g34745 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g150100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g35315.1   sequence type=CDS   gene model=Glyma01g35315   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAAACCGGAAAGAAAACCAAACCGACGGTGGCGGATCTTCTGAAATCACCGTCGCCGGTGGCTTCACCGACGGCGAATTCTCCGGCGATTTTCAAGAGAGCAGTTTCTTCCTCCTCCAAGGGCGCGAAGAGAGGTTCGCGAGTTGCTCTCGCCACCAGCACTTCTCCACCTCGCGGTCACAGAGCTCCGAGCAACATCTCCGACCTCAGGAACTTCGCCTCTTCCGGCGTCGACGATCTCAAACGCCGCATCGATCGCTCTCACTCCGAGATCCTCAAGGATCTCGAGGCTTCTAACTCTCGTCTCCACAAACGCTTCAAGATGCAGAATCAAGCATACCAGCAAGTTATGGATGAAGCAGAGAAGGAATACAAAAAGGTGTCTGAAAGAATAACGGAAAGCAGAGATGCAATGAAGGCCTCTTATGAAGAATTCATGGCAGAAGCACAAGCCAGCGCTTCTCGTGCATGCAAAACTTCAATCGTTGAGCTTTCGCAGTCGTTTGAGAAGGCTATTGACTCTCTTCGAAACCGTTACGGAATTCCATCAAATTAG

>Glyma01g35315.1   sequence type=predicted peptide   gene model=Glyma01g35315   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKTGKKTKPTVADLLKSPSPVASPTANSPAIFKRAVSSSSKGAKRGSRVALATSTSPPRGHRAPSNISDLRNFASSGVDDLKRRIDRSHSEILKDLEASNSRLHKRFKMQNQAYQQVMDEAEKEYKKVSERITESRDAMKASYEEFMAEAQASASRACKTSIVELSQSFEKAIDSLRNRYGIPSN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo