SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g34750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g34750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g34750

Feature Type:gene_model
Chromosome:Gm01
Start:47192343
stop:47193271
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g34750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14147AT Annotation by Michelle Graham. TAIR10: protein binding | chr4:8154079-8156246 REVERSE LENGTH=169 SoyBaseE_val: 7.00E-26ISS
PTHR22629Panther ARP2/3 COMPLEX 20 KD SUBUNIT JGI ISS
PF05856PFAM ARP2/3 complex 20 kDa subunit (ARPC4) JGI ISS
UniRef100_B9RWE0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Arp2/3 complex 20 kD subunit, putative n=1 Tax=Ricinus communis RepID=B9RWE0_RICCO SoyBaseE_val: 1.00E-22ISS
UniRef100_D7MH64UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MH64_ARALL SoyBaseE_val: 3.00E-23ISS

Expression Patterns of Glyma01g34750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g34750 not represented in the dataset
Glyma01g34750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g34750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g145800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g34750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g34750
>Glyma01g34750.1   sequence type=CDS   gene model=Glyma01g34750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAGGGCGATCACCACTCACCAGAGACTTCTAACTTATATCATTGAAATCCATTTTGATAACATTATATTGTTATTAATCCCTGTTCCGTTATTCTTTACAACATTAGGGAGAATTAATATCATCACTGGTCCTAATTTTTCTGGAAAAAATATCTATCTAAAGCAAGTCATCAATGAGCTTGAAAACATATTGACCAAAAAATTTCTAAGATTTTTGTCAATGAGAGTCGAGGCTTTCCAAGTACTGAGGAGAAAGCTTGTTCAGGGATATGACATTAGCTTCCTTATAACAAATTACCACTGTGAGGATATGACATTAGCTTCCTTTTTAAAATTTTAG
Predicted protein sequences of Glyma01g34750
>Glyma01g34750.1   sequence type=predicted peptide   gene model=Glyma01g34750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MERAITTHQRLLTYIIEIHFDNIILLLIPVPLFFTTLGRINIITGPNFSGKNIYLKQVINELENILTKKFLRFLSMRVEAFQVLRRKLVQGYDISFLITNYHCEDMTLASFLKF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo