Glyma01g34736 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g34736): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g34736): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g34736

Feature Type:	gene_model
Chromosome:	Gm01
Start:	47186499
stop:	47194135
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g34736

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G19350	AT	Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein \| chr5:6518978-6521295 FORWARD LENGTH=425	SoyBase	E_val: 7.00E-29	ISS
GO:0010048	GO-bp	Annotation by Michelle Graham. GO Biological Process: vernalization response	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0008143	GO-mf	Annotation by Michelle Graham. GO Molecular Function: poly(A) RNA binding	SoyBase	N/A	ISS
PTHR24012	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24012:SF67	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_G7IUB4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA-binding protein n=2 Tax=Medicago truncatula RepID=G7IUB4_MEDTR	SoyBase	E_val: 7.00E-43	ISS
UniRef100_I1M509	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M509_SOYBN	SoyBase	E_val: 2.00E-67	ISS

Expression Patterns of Glyma01g34736

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g34736 not represented in the dataset	Glyma01g34736 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g34736 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g145700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g34736

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g34736

Limit To All Plant Sequences

>Glyma01g34736.1   sequence type=CDS   gene model=Glyma01g34736   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGAAATGAACGGCGTTTATTGCTCCACCAGGCCCATGCGTATTAGTGCTGCTACGCCCAAGAAAACCACCGGTGCTTATGGTGCACCCGCCGCGCCTGTGCCCAAACCTGTGTATCCGGTTCCGGCCTATACTTCGCCTGTTGTTCAAGTTCAACCACCGGACTATGATGTCAATAATACTACCATTTTTGTTGGTAATTTGGATCTTAATGTGTCAGAGGAGGAGCTGAAGCAAAACTCTCTGCAATTTGGGGAAATTGTTTCTGTCAAAATTCAGCCTGGCAAGGGATTTGGTTTTGTTCAATTTGGGACCAGTTTAGGAAATTAG

Predicted protein sequences of Glyma01g34736

Limit To All Plant Sequences

>Glyma01g34736.1   sequence type=predicted peptide   gene model=Glyma01g34736   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTEMNGVYCSTRPMRISAATPKKTTGAYGAPAAPVPKPVYPVPAYTSPVVQVQPPDYDVNNTTIFVGNLDLNVSEEELKQNSLQFGEIVSVKIQPGKGFGFVQFGTSLGN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain