|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G01850 | AT | Annotation by Michelle Graham. TAIR10: endoxyloglucan transferase A3 | chr2:385374-387138 FORWARD LENGTH=333 | SoyBase | E_val: 1.00E-31 | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0006073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process | SoyBase | N/A | ISS |
| GO:0010087 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phloem or xylem histogenesis | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0004553 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds | SoyBase | N/A | ISS |
| GO:0016762 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity | SoyBase | N/A | ISS |
| GO:0016798 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds | SoyBase | N/A | ISS |
| PF00722 | PFAM | Glycosyl hydrolases family 16 | JGI | ISS | |
| UniRef100_A2TEJ2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglycosylase/hydrolase XTH-39 n=1 Tax=Populus tremula RepID=A2TEJ2_POPTN | SoyBase | E_val: 4.00E-34 | ISS |
| UniRef100_I1ND57 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ND57_SOYBN | SoyBase | E_val: 6.00E-38 | ISS |
|
Glyma01g34605 not represented in the dataset |
Glyma01g34605 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g144600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g34605.1 sequence type=CDS gene model=Glyma01g34605 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCAAATGGTGACATGTTCCAGAACAACCATGACGAGATATACTTTGAGTTTTTGGGGAACATTAGAGGCAAAGACCGGAGGATTCAGACCAATGTTTATGGCAATGGAAGCACCAGCATTGGTAGAGAGGAAAGATATGGCTTATGGTTTGATCTTGTTGAGGATTTCCATCAGTACAATATTCTTTGGACAAATTCTAAGATCATGTATGTATGA
>Glyma01g34605.1 sequence type=predicted peptide gene model=Glyma01g34605 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSNGDMFQNNHDEIYFEFLGNIRGKDRRIQTNVYGNGSTSIGREERYGLWFDLVEDFHQYNILWTNSKIMYV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||