Glyma01g34540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g34540

Feature Type:	gene_model
Chromosome:	Gm01
Start:	46906413
stop:	46911701
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g34540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G45420	AT	Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 18 \| chr2:18718601-18720445 FORWARD LENGTH=262	SoyBase	E_val: 4.00E-77	ISS
GO:0007155	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell adhesion	SoyBase	N/A	ISS
GO:0010089	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem development	SoyBase	N/A	ISS
GO:0010090	GO-bp	Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis	SoyBase	N/A	ISS
GO:0010311	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root formation	SoyBase	N/A	ISS
GO:0044036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process	SoyBase	N/A	ISS
GO:0045010	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin nucleation	SoyBase	N/A	ISS
GO:0048765	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PF03195	PFAM	Protein of unknown function DUF260	JGI		ISS
UniRef100_B9RDE1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RDE1_RICCO	SoyBase	E_val: 6.00E-86	ISS
UniRef100_I1J7Y2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J7Y2_SOYBN	SoyBase	E_val: 1.00E-177	ISS

Expression Patterns of Glyma01g34540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g34540

Paralog	Evidence	Comments
Glyma03g02620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g34540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g143900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g34540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g34540

Limit To All Plant Sequences

>Glyma01g34540.1   sequence type=CDS   gene model=Glyma01g34540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCATAAACTCTAGTTGTAGCATAAGTGGTGGGAGTAGTAGCGGTGGAAACAATAATAGTAGTGGTGGTAGCCCTTGTGGGGCGTGCAAGTTTTTGAGGCGAAAGTGCATGCCCGGTTGCATCTTTGCTCCGTACTTTGATTCGGAGGAAGGTGCCACGCACTTTGCCGCGGTGCATAAGGTTTTTGGTGCTAGTAACATTTCCAAGTTACTGCTTAACATTCCGGTGCATAAGAGGCTTGATGCGGTGGTCACAATTTGCTATGAAGCTCAAGCGAGGCTTAGAGACCCCGTGTATGGTTGTGTTGCTCATATCTTCGCTCTTCAGCAACAGGTGATGAGTTTACAAGCAGAACTCTCCTACTTACAAGGCCACCTTGCAACCCTAGAGTTACCCCAACCACCACCACCTTCTTCACCACAAGCAACCACCATGGCACCTCCTCCATTGATCTCAATAGCTGAGTTCATCCCATCATCAGCCTTAGCCTCTTCAACCGTGCCACCCACATATGACCTCTCTTCACTTTTTGATCCAATGGCCCAGACTCCTTCGTGGGCTGTGCAGCCTAGGCCCATAGAGTCACGTCAATATGTGGGTAGCGGGCCTAGTGGCCCATCGGCCACTATTGCTAGTGGTGGTGATCTTCAAGCATTGGCTCGTGAGCTTTTGCATAGACATGGATCTGCCCCAGTTGTTGCATGCTCTAATCCCTCTTCATCTTACCCGATTTCCAAATGA

Predicted protein sequences of Glyma01g34540

Limit To All Plant Sequences

>Glyma01g34540.1   sequence type=predicted peptide   gene model=Glyma01g34540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSINSSCSISGGSSSGGNNNSSGGSPCGACKFLRRKCMPGCIFAPYFDSEEGATHFAAVHKVFGASNISKLLLNIPVHKRLDAVVTICYEAQARLRDPVYGCVAHIFALQQQVMSLQAELSYLQGHLATLELPQPPPPSSPQATTMAPPPLISIAEFIPSSALASSTVPPTYDLSSLFDPMAQTPSWAVQPRPIESRQYVGSGPSGPSATIASGGDLQALARELLHRHGSAPVVACSNPSSSYPISK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain