SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g34466

Feature Type:gene_model
Chromosome:Gm01
Start:46825912
stop:46827713
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g34466
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08500AT Annotation by Michelle Graham. TAIR10: MAPK/ERK kinase kinase 1 | chr4:5404272-5407062 REVERSE LENGTH=608 SoyBaseE_val: 1.00E-41ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004709GO-mf Annotation by Michelle Graham. GO Molecular Function: MAP kinase kinase kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0019900GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase binding SoyBaseN/AISS
PTHR24361Panther MITOGEN-ACTIVATED KINASE KINASE KINASE JGI ISS
PTHR24361:SF63Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_J7M953UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase n=1 Tax=Nicotiana benthamiana RepID=J7M953_NICBE SoyBaseE_val: 2.00E-47ISS
UniRef100_UPI000233A903UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A903 related cluster n=1 Tax=unknown RepID=UPI000233A903 SoyBaseE_val: 2.00E-51ISS

Expression Patterns of Glyma01g34466
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g34466 not represented in the dataset
Glyma01g34466 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g34466 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g143400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g34466
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma01g34466
>Glyma01g34466.2   sequence type=transcript   gene model=Glyma01g34466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACACTTTGCTAAATGTTTATGCAGGATCAATCAAAGTTGTATATCTTTCTTGAGATTGTAACAAAAGGTTCCCTTAGAAGCCTCTATCAGAAGTATACTCTTCGAGATTCCCAAGTATCTTTCTATACGAGACAAATTCTACATGGTTTGAAATATCTTCATGACCGAAATGCGGTTCATAGGGATATCATATGTGCAAATATATTGGTGGATGCAAGTGGATTTGTCAAGCTTGCAGATTTTGGATTGGCAAAGGCAACCAAATTGAATGACGTTAAATCAATGAAAAGGACAACATTATGGATGGTGTCTACTATATGTGGTTGGTGTAGGACATGCCAAGAATGTAATATGTTAGTGTTGTGAACAAACTAGAGGTCGACACCTTGGTCATGGGGCTATGTATTCTTTAAGAGTTTGAAATTGATTATGTTGGTCAAAGTGAATTGGCATTAAATGAGGATCTATATAACACAAAGTACAAGGACAAGTTGGAGTTGTCTTATAAGGTACTGCTTAAACTGATTCATATGTAAATATATAACCCCTGAGATATTGCTCTTCAAGGACTGCTTGGGAAAATGGAAAAGAGCATCTTGCATATTTAAACATCATGACGCAGTAGCTGATGTGTTTCATTCTCAATTCAATAACCAGGGACTTATTCAT
Coding sequences of Glyma01g34466
>Glyma01g34466.1   sequence type=CDS   gene model=Glyma01g34466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTATGCAGGATCAATCAAAGTTGTATATCTTTCTTGAGATTGTAACAAAAGGTTCCCTTAGAAGCCTCTATCAGAAGTATACTCTTCGAGATTCCCAAGTATCTTTCTATACGAGACAAATTCTACATGGTTTGAAATATCTTCATGACCGAAATGCGGTTCATAGGGATATCATATGTGCAAATATATTGGTGGATGCAAGTGGATTTGTCAAGCTTGCAGATTTTGGATTGGCAAAGGCAACCAAATTGAATGACGTTAAATCAATGAAAAGGACAACATTATGGATGGTGTCTACTATATGTGGTTGGTGTAGGACATGCCAAGAATGTAATATGTTAGTGTTGTGA

>Glyma01g34466.2   sequence type=CDS   gene model=Glyma01g34466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTATGCAGGATCAATCAAAGTTGTATATCTTTCTTGAGATTGTAACAAAAGGTTCCCTTAGAAGCCTCTATCAGAAGTATACTCTTCGAGATTCCCAAGTATCTTTCTATACGAGACAAATTCTACATGGTTTGAAATATCTTCATGACCGAAATGCGGTTCATAGGGATATCATATGTGCAAATATATTGGTGGATGCAAGTGGATTTGTCAAGCTTGCAGATTTTGGATTGGCAAAGGCAACCAAATTGAATGACGTTAAATCAATGAAAAGGACAACATTATGGATGGTGTCTACTATATGTGGTTGGTGTAGGACATGCCAAGAATGTAATATGTTAGTGTTGTGA
Predicted protein sequences of Glyma01g34466
>Glyma01g34466.1   sequence type=predicted peptide   gene model=Glyma01g34466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFMQDQSKLYIFLEIVTKGSLRSLYQKYTLRDSQVSFYTRQILHGLKYLHDRNAVHRDIICANILVDASGFVKLADFGLAKATKLNDVKSMKRTTLWMVSTICGWCRTCQECNMLVL*

>Glyma01g34466.2   sequence type=predicted peptide   gene model=Glyma01g34466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFMQDQSKLYIFLEIVTKGSLRSLYQKYTLRDSQVSFYTRQILHGLKYLHDRNAVHRDIICANILVDASGFVKLADFGLAKATKLNDVKSMKRTTLWMVSTICGWCRTCQECNMLVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo