SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g34111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g34111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g34111

Feature Type:gene_model
Chromosome:Gm01
Start:46405623
stop:46406054
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35790AT Annotation by Michelle Graham. TAIR10: phospholipase D delta | chr4:16956681-16959875 REVERSE LENGTH=693 SoyBaseE_val: 4.00E-30ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009789GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0012501GO-bp Annotation by Michelle Graham. GO Biological Process: programmed cell death SoyBaseN/AISS
GO:0046473GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidic acid metabolic process SoyBaseN/AISS
GO:0090333GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal closure SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0015630GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule cytoskeleton SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004630GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipase D activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
PTHR18896Panther PHOSPHOLIPASE D JGI ISS
PTHR18896:SF13Panther PHOSPHOLIPASE D DELTA JGI ISS
UniRef100_I1JSY8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phospholipase D n=1 Tax=Glycine max RepID=I1JSY8_SOYBN SoyBaseE_val: 6.00E-45ISS
UniRef100_UPI000233997FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233997F related cluster n=1 Tax=unknown RepID=UPI000233997F SoyBaseE_val: 4.00E-45ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g34111 not represented in the dataset

Glyma01g34111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g141500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g34111.1   sequence type=CDS   gene model=Glyma01g34111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACCATGGCATGATTTACATTGCAAAATTGAAGGCCCTGCTGCATATGATATACTCACTAATTTTGAGCAACGTTGGAGAAAAGCCACCAAATGGTCTGAGTTGGGTCGGAAACTCAAGAGAGTATCTAACTGGAACGATGATTCTTTGATCAAGTTAGAATGCATCTCTTGGATTCTTAGTCCTTCGGAATCAACTCCAATTGATGTTCCTGAACTATGGGTTTCGAAGGAAGACGATCCTTAA

>Glyma01g34111.1   sequence type=predicted peptide   gene model=Glyma01g34111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQPWHDLHCKIEGPAAYDILTNFEQRWRKATKWSELGRKLKRVSNWNDDSLIKLECISWILSPSESTPIDVPELWVSKEDDP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo