|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G35790 | AT | Annotation by Michelle Graham. TAIR10: phospholipase D delta | chr4:16956681-16959875 REVERSE LENGTH=693 | SoyBase | E_val: 4.00E-30 | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009789 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0012501 | GO-bp | Annotation by Michelle Graham. GO Biological Process: programmed cell death | SoyBase | N/A | ISS |
| GO:0046473 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phosphatidic acid metabolic process | SoyBase | N/A | ISS |
| GO:0090333 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of stomatal closure | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0015630 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: microtubule cytoskeleton | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004630 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phospholipase D activity | SoyBase | N/A | ISS |
| GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
| PTHR18896 | Panther | PHOSPHOLIPASE D | JGI | ISS | |
| PTHR18896:SF13 | Panther | PHOSPHOLIPASE D DELTA | JGI | ISS | |
| UniRef100_I1JSY8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Phospholipase D n=1 Tax=Glycine max RepID=I1JSY8_SOYBN | SoyBase | E_val: 6.00E-45 | ISS |
| UniRef100_UPI000233997F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233997F related cluster n=1 Tax=unknown RepID=UPI000233997F | SoyBase | E_val: 4.00E-45 | ISS |
|
Glyma01g34111 not represented in the dataset |
Glyma01g34111 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g141500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g34111.1 sequence type=CDS gene model=Glyma01g34111 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAACCATGGCATGATTTACATTGCAAAATTGAAGGCCCTGCTGCATATGATATACTCACTAATTTTGAGCAACGTTGGAGAAAAGCCACCAAATGGTCTGAGTTGGGTCGGAAACTCAAGAGAGTATCTAACTGGAACGATGATTCTTTGATCAAGTTAGAATGCATCTCTTGGATTCTTAGTCCTTCGGAATCAACTCCAATTGATGTTCCTGAACTATGGGTTTCGAAGGAAGACGATCCTTAA
>Glyma01g34111.1 sequence type=predicted peptide gene model=Glyma01g34111 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQPWHDLHCKIEGPAAYDILTNFEQRWRKATKWSELGRKLKRVSNWNDDSLIKLECISWILSPSESTPIDVPELWVSKEDDP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||