Glyma01g33635 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g33635): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g33635): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g33635

Feature Type:	gene_model
Chromosome:	Gm01
Start:	45827325
stop:	45830713
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g33635

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G08870	AT	Annotation by Michelle Graham. TAIR10: Arginase/deacetylase superfamily protein \| chr4:5646654-5648693 REVERSE LENGTH=344	SoyBase	E_val: 3.00E-111	ISS
GO:0006560	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline metabolic process	SoyBase	N/A	ISS
GO:0006570	GO-bp	Annotation by Michelle Graham. GO Biological Process: tyrosine metabolic process	SoyBase	N/A	ISS
GO:0006591	GO-bp	Annotation by Michelle Graham. GO Biological Process: ornithine metabolic process	SoyBase	N/A	ISS
GO:0006595	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine metabolic process	SoyBase	N/A	ISS
GO:0009445	GO-bp	Annotation by Michelle Graham. GO Biological Process: putrescine metabolic process	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004053	GO-mf	Annotation by Michelle Graham. GO Molecular Function: arginase activity	SoyBase	N/A	ISS
GO:0008783	GO-mf	Annotation by Michelle Graham. GO Molecular Function: agmatinase activity	SoyBase	N/A	ISS
GO:0016813	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
KOG2964	KOG	Arginase family protein	JGI		ISS
PTHR11358	Panther	ARGINASE/AGMATINASE-RELATED	JGI		ISS
PTHR11358:SF4	Panther	AGMATINASE-RELATED	JGI		ISS
PF00491	PFAM	Arginase family	JGI		ISS
UniRef100_I1J7U7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J7U7_SOYBN	SoyBase	E_val: 3.00E-138	ISS
UniRef100_O49046	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Arginase n=1 Tax=Glycine max RepID=ARGI_SOYBN	SoyBase	E_val: 3.00E-126	ISS

Expression Patterns of Glyma01g33635

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g33635 not represented in the dataset	Glyma01g33635 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g33635 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g139300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g33635

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g33635

Limit To All Plant Sequences

>Glyma01g33635.1   sequence type=CDS   gene model=Glyma01g33635   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGACACATACCTGATCTCATTAAAAAAGTAGTGTTAATTGGTTTTCTTCAAAAAGAACTTGTGCATAGTTTGGGAGGTGCTGTAGCAACTTCAACTCTTCTTGGAGTTCCTTTGGGACATAATTCATTGTTTCGTGAAGGACCTTCATTTGCACCTCCTTTCATTTGGGAGGGTATTTGGTGTGGTAGTGCAAACTCCACAACTGAAGAAGGAAAGGATTTAAAGGACTTGCGAATAATGGCTGATGTTGGTGATATCCCTATTCAAGAAATTGATGAAAGAGGTAAATTGTTAATTTTTGTTAGAGCCATACCTGAGAACCTTGGGGGACCGGTTGATGTTCTTCGTTTTGATGCACATCCTGATCTTTATGATAAATTTGAAGGAAAGTATTATTCGCGCGCTTCTTCTTTTGCTCGAATCATGGAGGGTGGTTATATATGCTCGCTGACTCTTGTTGACATAAGATCAATAAATAAAGAAGGGCGTGAACAAGCCAAAAAGTTCGGGATAAAACAGTATGAAATGCGACATTTTTCGAAAGATCGCCCATTTTTGGAGAACCTGAAACTAGGAGAAGGTGTCAAAGGCGTATACATCTCAATCGATGTGGATTGTCTCGATCCAGGGTATGCTGTAGGAGTGTCCCATTATGAATCAGGAGGTGACATTGTTGGTGGAGACATGATTGAATACAACCCACAACGTGACACTCCTGATCGTATGATTGCCATGGTAGCAAAGATGTCAAAATGA

Predicted protein sequences of Glyma01g33635

Limit To All Plant Sequences

>Glyma01g33635.1   sequence type=predicted peptide   gene model=Glyma01g33635   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MERHIPDLIKKVVLIGFLQKELVHSLGGAVATSTLLGVPLGHNSLFREGPSFAPPFIWEGIWCGSANSTTEEGKDLKDLRIMADVGDIPIQEIDERGKLLIFVRAIPENLGGPVDVLRFDAHPDLYDKFEGKYYSRASSFARIMEGGYICSLTLVDIRSINKEGREQAKKFGIKQYEMRHFSKDRPFLENLKLGEGVKGVYISIDVDCLDPGYAVGVSHYESGGDIVGGDMIEYNPQRDTPDRMIAMVAKMSK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain