SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g33313

Feature Type:gene_model
Chromosome:Gm01
Start:45306251
stop:45306442
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g33313
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATMG01320AT Annotation by Michelle Graham. TAIR10: NADH dehydrogenase 2B | chrM:327890-333105 REVERSE LENGTH=499 SoyBaseE_val: 1.00E-20ISS
GO:0042773GO-bp Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled electron transport SoyBaseN/AISS
GO:0045333GO-bp Annotation by Michelle Graham. GO Biological Process: cellular respiration SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003954GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
UniRef100_F6HEV2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=F6HEV2_VITVI SoyBaseE_val: 1.00E-21ISS
UniRef100_G7I9T5UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase subunit n=1 Tax=Medicago truncatula RepID=G7I9T5_MEDTR SoyBaseE_val: 8.00E-21ISS

Expression Patterns of Glyma01g33313
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g33313 not represented in the dataset
Glyma01g33313 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g33313 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g136800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g33313
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g33313
>Glyma01g33313.1   sequence type=CDS   gene model=Glyma01g33313   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTATGAGTCTACTGGAGCTACCCACTTCGATCAATTAGCCAAGATTTTGATCGGATACGAAATCATTGGTGCTCAATATAGTGGTATTTTTATGGGGATTCTATCTATCGTTGTAGGATCCCTATTCAAGATCACTACAATTCCTTTTCGGGCATCTATAGAATGGATGACCGTCTATAGGTGGTAG
Predicted protein sequences of Glyma01g33313
>Glyma01g33313.1   sequence type=predicted peptide   gene model=Glyma01g33313   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIYESTGATHFDQLAKILIGYEIIGAQYSGIFMGILSIVVGSLFKITTIPFRASIEWMTVYRW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo