SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g33052

Feature Type:gene_model
Chromosome:Gm01
Start:44724346
stop:44725089
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g33052
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12244AT Annotation by Michelle Graham. TAIR10: Polynucleotidyl transferase, ribonuclease H-like superfamily protein | chr1:4157719-4158893 FORWARD LENGTH=254 SoyBaseE_val: 7.00E-16ISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
UniRef100_B9SP56UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hydrolase, acting on ester bonds, putative n=1 Tax=Ricinus communis RepID=B9SP56_RICCO SoyBaseE_val: 2.00E-14ISS
UniRef100_I1JKV7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JKV7_SOYBN SoyBaseE_val: 1.00E-23ISS

Expression Patterns of Glyma01g33052
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g33052 not represented in the dataset
Glyma01g33052 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g33052
ParalogEvidenceComments
Glyma03g03920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g33052 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g33052
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g33052
>Glyma01g33052.1   sequence type=CDS   gene model=Glyma01g33052   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTGATTGTCGCTGTCGATGTAAAGACGAATAATTTAGTAAAGGCATTAACTTTGGATGAACTTCCCCCAAACGCGCTTCGGAAGAAGAGACAACCGCAATGGAGAGGAGGCTTCAGCCGGGGACTCGACTTGGGATTGGCTCGCATTGGCCTTGCACTCAGCAAAGGCTTCTTTATTCGCCCTTTAACCAAAAATCAATTTCACTTCACTGTTTCTATGAAATTTGGATGA
Predicted protein sequences of Glyma01g33052
>Glyma01g33052.1   sequence type=predicted peptide   gene model=Glyma01g33052   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLIVAVDVKTNNLVKALTLDELPPNALRKKRQPQWRGGFSRGLDLGLARIGLALSKGFFIRPLTKNQFHFTVSMKFG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo