Glyma01g32230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g32230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g32230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g32230

Feature Type:	gene_model
Chromosome:	Gm01
Start:	43687455
stop:	43687922
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g32230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G11830	AT	Annotation by Michelle Graham. TAIR10: TCP-1/cpn60 chaperonin family protein \| chr3:3732734-3736156 FORWARD LENGTH=557	SoyBase	E_val: 3.00E-62	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0042545	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall modification	SoyBase	N/A	ISS
GO:0044267	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0051082	GO-mf	Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding	SoyBase	N/A	ISS
PTHR11353	Panther	CHAPERONIN	JGI		ISS
PF00118	PFAM	TCP-1/cpn60 chaperonin family	JGI		ISS
UniRef100_G7K2W1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit eta n=1 Tax=Medicago truncatula RepID=G7K2W1_MEDTR	SoyBase	E_val: 2.00E-62	ISS
UniRef100_I1M7B9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M7B9_SOYBN	SoyBase	E_val: 2.00E-63	ISS

Expression Patterns of Glyma01g32230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g32230 not represented in the dataset	Glyma01g32230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g32230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g130400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g32230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g32230

Limit To All Plant Sequences

>Glyma01g32230.1   sequence type=CDS   gene model=Glyma01g32230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAGGGAAGCCACAGCTGGTGAGCAACATCAATGCCTGCACTGCCGTCGCCGACGTCGTCCGCACCACCCTCGACCCTCGCGGCATGGACAAGCTCATCCACGACGACAAGGGAACCGTCACCATCTCCAACGACGGCGCCACCATCATGAAGCTCCTCGACATCGTCCACCCCGCTGCAAAAATCCTCGCCGACATCGCCAAGTCTCAGGACTCCGAGGTTGGCGATGGAACCACCAATGTGGTGTTGCTTGCAGCTGAGTTTTTAAGGGAGGCCAAGCCATTCATTGAAGATGGTGTTCACTCTCAAAACTTTATAAAA

Predicted protein sequences of Glyma01g32230

Limit To All Plant Sequences

>Glyma01g32230.1   sequence type=predicted peptide   gene model=Glyma01g32230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QGKPQLVSNINACTAVADVVRTTLDPRGMDKLIHDDKGTVTISNDGATIMKLLDIVHPAAKILADIAKSQDSEVGDGTTNVVLLAAEFLREAKPFIEDGVHSQNFIK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain