|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G59320 | AT | Annotation by Michelle Graham. TAIR10: lipid transfer protein 3 | chr5:23929051-23929492 FORWARD LENGTH=115 | SoyBase | E_val: 1.00E-30 | ISS |
| GO:0006869 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid transport | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
| GO:0042538 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0008289 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: lipid binding | SoyBase | N/A | ISS |
| PF00234 | PFAM | Protease inhibitor/seed storage/LTP family | JGI | ISS | |
| UniRef100_I1J7L8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Glycine max RepID=I1J7L8_SOYBN | SoyBase | E_val: 1.00E-63 | ISS |
| UniRef100_UPI0002336F98 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002336F98 related cluster n=1 Tax=unknown RepID=UPI0002336F98 | SoyBase | E_val: 2.00E-74 | ISS |
|
Glyma01g32140 not represented in the dataset |
Glyma01g32140 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g130000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g32140.2 sequence type=CDS gene model=Glyma01g32140 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTAGCCTCAAGTTTGCATGCGTAGTTGCGGTGATATGCATGGTTGTGGTGATCACTGCACCCATGACAAATGCCATCACGTGCGGGGAAGTAGCCAGATCCCTATCTCCATGCATCAATTACCTTCGGAGCCGCCGCGGCGGATCACCGGAGGCGGAATGCTGCAGAGGAGTCACGAGCCTCAACCGCGCCGCCAGTAACACCGCCGACCGACGCACCGCGTGCAATTGCCTGAAATCCGTTGCCGCTTCTATTTCTGGTTTAAATGCCAACAACGCAGCTTCACTCCCCGGGAGATGTAGAGTCAGGGTGCCCTACAGGATCAGCACCTCCACCAACTGCAACAGGATCAGGTAA
>Glyma01g32140.2 sequence type=predicted peptide gene model=Glyma01g32140 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASLKFACVVAVICMVVVITAPMTNAITCGEVARSLSPCINYLRSRRGGSPEAECCRGVTSLNRAASNTADRRTACNCLKSVAASISGLNANNAASLPGRCRVRVPYRISTSTNCNRIR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||