Glyma01g31610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g31610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g31610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g31610

Feature Type:	gene_model
Chromosome:	Gm01
Start:	42631341
stop:	42634983
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g31610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G01650	AT	Annotation by Michelle Graham. TAIR10: Tautomerase/MIF superfamily protein \| chr5:242734-244033 REVERSE LENGTH=115	SoyBase	E_val: 3.00E-64	ISS
GO:0006954	GO-bp	Annotation by Michelle Graham. GO Biological Process: inflammatory response	SoyBase	N/A	ISS
GO:0051707	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to other organism	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1759	KOG	Macrophage migration inhibitory factor	JGI		ISS
PTHR11954	Panther	MACROPHAGE MIGRATION INHIBITORY FACTOR RELATED	JGI		ISS
PTHR11954:SF3	Panther	MACROPHAGE MIGRATION INHIBITORY FACTOR-RELATED	JGI		ISS
PF01187	PFAM	Macrophage migration inhibitory factor (MIF)	JGI		ISS
UniRef100_B3TLP2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Light-inducible protein ATLS1 n=1 Tax=Elaeis guineensis RepID=B3TLP2_ELAGV	SoyBase	E_val: 1.00E-67	ISS
UniRef100_I1J7I5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J7I5_SOYBN	SoyBase	E_val: 1.00E-75	ISS

Expression Patterns of Glyma01g31610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g31610 not represented in the dataset	Glyma01g31610 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g31610

Paralog	Evidence	Comments
Glyma03g05620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g31610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g126000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g31610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g31610

Limit To All Plant Sequences

>Glyma01g31610.1   sequence type=CDS   gene model=Glyma01g31610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGTGCCTCAACCTCAACACCAACGTGTCCCTCGACGGCGTCGACACCTCTTCCATCCTCGCCGAAGCCACCTCCTCCGTTGCCAACATCATCGGCAAACCCGCGGCCTATGTGATGATTGTACTGAAAGGATCAGTACCCATAGCTTTTGGTGGGAATGAACAGCCAGCAGCTTATGGAGAATTGGTGTCCATTGGTGGTCTTAACCCTAGTGTAAACAAGGAACTTAGTGCTGCAATTGCTTCAATTCTGGAAACCAAATTGTCGGTGCCCAAGTCACGGTTCTTCTTGAAATTCTATGACACCAAGGGTTCCAACTTTGGATGGAATGGATCTACATTCTGA

Predicted protein sequences of Glyma01g31610

Limit To All Plant Sequences

>Glyma01g31610.1   sequence type=predicted peptide   gene model=Glyma01g31610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPCLNLNTNVSLDGVDTSSILAEATSSVANIIGKPAAYVMIVLKGSVPIAFGGNEQPAAYGELVSIGGLNPSVNKELSAAIASILETKLSVPKSRFFLKFYDTKGSNFGWNGSTF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain