SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g29656): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g29656): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g29656

Feature Type:gene_model
Chromosome:Gm01
Start:39965928
stop:39966511
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g29656
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07950AT Annotation by Michelle Graham. TAIR10: rhomboid protein-related | chr3:2531982-2534277 FORWARD LENGTH=304 SoyBaseE_val: 4.00E-54ISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13377Panther PLACENTAL PROTEIN 6 JGI ISS
UniRef100_G7I9J5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7I9J5_MEDTR SoyBaseE_val: 3.00E-62ISS
UniRef100_I1JCX7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JCX7_SOYBN SoyBaseE_val: 3.00E-78ISS

Expression Patterns of Glyma01g29656
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g29656 not represented in the dataset
Glyma01g29656 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g29656 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g120700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g29656
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g29656
>Glyma01g29656.1   sequence type=CDS   gene model=Glyma01g29656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGTTCTAGTTACATGCCACTTTCTGGATTTCATGGAGTTGTATCTGGTTTCTTGGTTGGCATTAAGTTTGATACTCTTTTGTGGTTGTCATCTATCCCTGTATTGCTTTCCATTGCTATTAGCTTCTGGACACTAGAGGCTACAACATATCTTCCAACCATTATATTTGGCACGTATATAAGTTGGATTTATCTTAGATACTGGCAGAGAAAACCAGAAACTAAACATAGAGGTGATCTGAGTGAAGATTTTGCTTTCTCCACATTTTCCCCAGAATTTTTAAGACTAGTCATAGACCCTATTGCTTCAATATTTCATCGAATGCTCAATGGAAGATATGATGCTTCTAATGATGGTCAAGGCAACAATATGGAAAGTGAGCCTTTACCAGGTTCGGACTCAATTGAGGCATCCAGGAGACGATAA
Predicted protein sequences of Glyma01g29656
>Glyma01g29656.1   sequence type=predicted peptide   gene model=Glyma01g29656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDCSSYMPLSGFHGVVSGFLVGIKFDTLLWLSSIPVLLSIAISFWTLEATTYLPTIIFGTYISWIYLRYWQRKPETKHRGDLSEDFAFSTFSPEFLRLVIDPIASIFHRMLNGRYDASNDGQGNNMESEPLPGSDSIEASRRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo