SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g29410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g29410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g29410

Feature Type:gene_model
Chromosome:Gm01
Start:39591647
stop:39594997
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g29410
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58590AT Annotation by Michelle Graham. TAIR10: RAN binding protein 1 | chr5:23680319-23681714 REVERSE LENGTH=219 SoyBaseE_val: 2.00E-94ISS
GO:0000060GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus, translocation SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0046907GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0864 KOG Ran-binding protein RANBP1 and related RanBD domain proteins JGI ISS
PTHR23138Panther RAN BINDING PROTEIN JGI ISS
PTHR23138:SF10Panther RAN BINDING PROTEIN JGI ISS
PF00638PFAM RanBP1 domain JGI ISS
UniRef100_B9RSC5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ran binding protein, putative n=1 Tax=Ricinus communis RepID=B9RSC5_RICCO SoyBaseE_val: 4.00E-103ISS
UniRef100_I1J7C7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J7C7_SOYBN SoyBaseE_val: 4.00E-165ISS

Expression Patterns of Glyma01g29410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g29410 not represented in the dataset
Glyma01g29410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g29410
ParalogEvidenceComments
Glyma03g07411 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g29410 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g119300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g29410
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g29410
>Glyma01g29410.1   sequence type=CDS   gene model=Glyma01g29410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACCACCGAGCCGGAGCACCGCCGCGACGAAAACGACGACGACAGCGTGACGGCGGAGGATGAGGACACCGGAGCGCAGGTCGCTCCGATCGTGAAGCTCGAAGAGGTCGCCGTCACCACCGGCGAGGAGGACGAGGATCCCATCCTTGATCTGAAGGCGAAGCTGTATCGGTTTGACAAGGAGGGGAACCAGTGGAAGGAGCGTGGCGGCGGGAACGTTAAGCTGCTGAAACATAAGGTCACCGGGAAGGTGAGACTAGTGATGCGCCAATCCAAGACGCTCAAGATCTGCGCAAATCATCTCGTTCATCACAGTTTGACGGTACAGGAGCATTCTGGGAATGAGAAATCGTGTGTGTGGCATGCTTCTGATTTTGCAGATGGGGAATTGAAGGATGAGCTGTTCTGTATTAGGTTTCCCTCTGTTGAGAACTGTAAGGCCTTCATGACAACTATGCAAGAAGTGGCAGAATCACAAGGAGAAGGGGAGGAAAACAAAGATGCTTCGGCTACTGCCGATCTCCTCGAGAAACTAACTGTTGGTGAAGACAAATCAGACGAGAAAGAGCCGGAAAAGGTCCAGATCACCAAGAAACTAACTGTTGGCGAGGATAAATCGGAGGATGAAGAGCCGGAAATGGCCACAAACACCAATGAGAAAGGTGAGCAGGATGTAGAAGCCTGA
Predicted protein sequences of Glyma01g29410
>Glyma01g29410.1   sequence type=predicted peptide   gene model=Glyma01g29410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATTEPEHRRDENDDDSVTAEDEDTGAQVAPIVKLEEVAVTTGEEDEDPILDLKAKLYRFDKEGNQWKERGGGNVKLLKHKVTGKVRLVMRQSKTLKICANHLVHHSLTVQEHSGNEKSCVWHASDFADGELKDELFCIRFPSVENCKAFMTTMQEVAESQGEGEENKDASATADLLEKLTVGEDKSDEKEPEKVQITKKLTVGEDKSEDEEPEMATNTNEKGEQDVEA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo