SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g28890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g28890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g28890

Feature Type:gene_model
Chromosome:Gm01
Start:38825960
stop:38830479
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51870AT Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein | chr3:19243978-19246611 FORWARD LENGTH=381 SoyBaseE_val: 3.00E-78ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
KOG0752 KOG Mitochondrial solute carrier protein JGI ISS
PTHR24089Panther FAMILY NOT NAMED JGI ISS
PTHR24089:SF87Panther SUBFAMILY NOT NAMED JGI ISS
PF00153PFAM Mitochondrial carrier protein JGI ISS
UniRef100_G7JP47UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid ADP,ATP carrier protein n=1 Tax=Medicago truncatula RepID=G7JP47_MEDTR SoyBaseE_val: 1.00E-87ISS
UniRef100_UPI0002336C7CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336C7C related cluster n=1 Tax=unknown RepID=UPI0002336C7C SoyBaseE_val: 5.00E-110ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g28890 not represented in the dataset

Glyma01g28890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g08120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g116800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g28890.3   sequence type=transcript   gene model=Glyma01g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAACTTACCCATTAGATGTCCTGTGATTACGATTAGTTGTTGAACCTGGTTATCGAACAATGTCAGAGGTTGCCTTGAGCATGCTAAGAGAGGAAGGATTTGCATCTTTCTACTATGGCCTTGGGCCTTCTCTGATTGGAATAGCTCCATATATTGCAGTGAACTTTTGTGTTTTTGATTTATTAAAGAAGTCGTTGCCAGAGAAATATCAAAAGAGACCTGAAACATCTCTACTCACTGCTGTGTTTTTTGCATCACTTGCCACACTTACATGCTATCCTCTGGATACAGTGCGAAGACAGATGCAATTGAAGGCTGCGCCTTATAAGACAGTCTTAGATGTCATTTCAATCCTTGTTTATCTCTACAGTATCATGCTTACTACATATGACATTGTCGAACGTCTAATTGCCGCTAGTGAGAAAGAATTTCAAACAATTACTGAGGAAAACCGCAACAAACAAAAGAAACCCCAATAA

>Glyma01g28890.2   sequence type=CDS   gene model=Glyma01g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACACGGAAGGAAGAAGGCATCAAAGGTTATTGGAAGGGCAACCTCCCCCAGTTGATTCGGGTTATACCTTATAGTGCTGTCCAGCTTTTTGCATATGAAATTTACAAGAAAATATTCAAGGGAAATGATGGTGAGCTCTCTGTTGTGGGAAGACTTGCAGCAGGTACTTTTGCTGACATGATATCAACTTTTGTTGCCTTGAGCATGCTAAGAGAGGAAGGATTTGCATCTTTCTACTATGGCCTTGGGCCTTCTCTGATTGGAATAGCTCCATATATTGCAAAGTCGTTGCCAGAGAAATATCAAAAGAGACCTGAAACATCTCTACTCACTGCTGTGTTTTTTGCATCACTTGCCACACTTACATGCTATCCTCTGGATACAGTGCGAAGACAGATGCAATTGAAGGCTGCGCCTTATAAGACAGTCTTAGATGTCATTTCAATCCTTGTTTATCTCTACAGTATCATGCTTACTACATATGACATTGTCGAACGTCTAATTGCCGCTAGTGAGAAAGAATTTCAAACAATTACTGAGGAAAACCGCAACAAACAAAAGAAACCCCAATAA

>Glyma01g28890.3   sequence type=CDS   gene model=Glyma01g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGAGGTTGCCTTGAGCATGCTAAGAGAGGAAGGATTTGCATCTTTCTACTATGGCCTTGGGCCTTCTCTGATTGGAATAGCTCCATATATTGCAGTGAACTTTTGTGTTTTTGATTTATTAAAGAAGTCGTTGCCAGAGAAATATCAAAAGAGACCTGAAACATCTCTACTCACTGCTGTGTTTTTTGCATCACTTGCCACACTTACATGCTATCCTCTGGATACAGTGCGAAGACAGATGCAATTGAAGGCTGCGCCTTATAAGACAGTCTTAGATGTCATTTCAATCCTTGTTTATCTCTACAGTATCATGCTTACTACATATGACATTGTCGAACGTCTAATTGCCGCTAGTGAGAAAGAATTTCAAACAATTACTGAGGAAAACCGCAACAAACAAAAGAAACCCCAATAA

>Glyma01g28890.2   sequence type=predicted peptide   gene model=Glyma01g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTRKEEGIKGYWKGNLPQLIRVIPYSAVQLFAYEIYKKIFKGNDGELSVVGRLAAGTFADMISTFVALSMLREEGFASFYYGLGPSLIGIAPYIAKSLPEKYQKRPETSLLTAVFFASLATLTCYPLDTVRRQMQLKAAPYKTVLDVISILVYLYSIMLTTYDIVERLIAASEKEFQTITEENRNKQKKPQ*

>Glyma01g28890.3   sequence type=predicted peptide   gene model=Glyma01g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEVALSMLREEGFASFYYGLGPSLIGIAPYIAVNFCVFDLLKKSLPEKYQKRPETSLLTAVFFASLATLTCYPLDTVRRQMQLKAAPYKTVLDVISILVYLYSIMLTTYDIVERLIAASEKEFQTITEENRNKQKKPQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo