|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G60540 | AT | Annotation by Michelle Graham. TAIR10: pyridoxine biosynthesis 2 | chr5:24336874-24338647 REVERSE LENGTH=255 | SoyBase | E_val: 3.00E-39 | ISS |
| GO:0008615 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pyridoxine biosynthetic process | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0042819 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vitamin B6 biosynthetic process | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0004359 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glutaminase activity | SoyBase | N/A | ISS |
| GO:0046982 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity | SoyBase | N/A | ISS |
| PF01174 | PFAM | SNO glutamine amidotransferase family | JGI | ISS | |
| UniRef100_C6TDU5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TDU5_SOYBN | SoyBase | E_val: 3.00E-45 | ISS |
| UniRef100_G7JN26 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glutamine amidotransferase subunit pdxT n=1 Tax=Medicago truncatula RepID=G7JN26_MEDTR | SoyBase | E_val: 1.00E-38 | ISS |
|
Glyma01g27765 not represented in the dataset |
Glyma01g27765 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g112800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g27765.1 sequence type=CDS gene model=Glyma01g27765 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACTAACATCATTTCAGGGCAGAAGACTGGTGGACAATATTTGGTTGGTGGACTTGATTGTACAGTGCATATAAATTTCTTTGGTAGCCAGATTCAAAGCTTTGAGGCAGAGCTTTTAGTGCCAGAGCTTGTCTCCAAGGAAGGAGGTCCTGAATCATTTTGTGGAATTTTTATTCATGCCCCTGCAATTCTTGAAGCAGGGCCAAAAGTTCAAGTGCTGGCTGATTATCCTGTACCTTCTAGCAAATTGTTGAGTTTTGATTCCTCTATTGAAGACCAAACAGTTAATTAA
>Glyma01g27765.1 sequence type=predicted peptide gene model=Glyma01g27765 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTNIISGQKTGGQYLVGGLDCTVHINFFGSQIQSFEAELLVPELVSKEGGPESFCGIFIHAPAILEAGPKVQVLADYPVPSSKLLSFDSSIEDQTVN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||