SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g27410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g27410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g27410

Feature Type:gene_model
Chromosome:Gm01
Start:36654804
stop:36655111
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g27410
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G24940AT Annotation by Michelle Graham. TAIR10: membrane-associated progesterone binding protein 2 | chr2:10609447-10609749 FORWARD LENGTH=100 SoyBaseE_val: 5.00E-34ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR10281Panther MEMBRANE ASSOCIATED PROGESTERONE RECEPTOR-RELATED JGI ISS
PF00173PFAM Cytochrome b5-like Heme/Steroid binding domain JGI ISS
UniRef100_D7LJH3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Membrane-associated progesterone binding protein 2 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LJH3_ARALL SoyBaseE_val: 8.00E-32ISS
UniRef100_I1J776UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1J776_SOYBN SoyBaseE_val: 2.00E-44ISS

Expression Patterns of Glyma01g27410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g27410 not represented in the dataset
Glyma01g27410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g27410 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g112100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g27410
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g27410
>Glyma01g27410.2   sequence type=CDS   gene model=Glyma01g27410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGCCAGCTGTGTGAAGGGAGGGGGCCACGTCTACGATGTCAGCATCGAAAAATCCTTTTACAGCCTCGGCGGCCCCTACGCCATGTTCGCCGGCAAAGACGCTAGCAGAGCCCTGGCGAAGATGAGCAAGAATGACGACGACATCTCCCCCTCCCTCGATGACCTCTCTGACAAGGAGATCGACATTCTCAACGACTGGGAGAACAAATTCCAAGCTAAGTACCCTGTGGTTGCTCGTGTTCTCAATTAA
Predicted protein sequences of Glyma01g27410
>Glyma01g27410.2   sequence type=predicted peptide   gene model=Glyma01g27410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVASCVKGGGHVYDVSIEKSFYSLGGPYAMFAGKDASRALAKMSKNDDDISPSLDDLSDKEIDILNDWENKFQAKYPVVARVLN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo