SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g27385): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g27385): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g27385

Feature Type:gene_model
Chromosome:Gm01
Start:36610053
stop:36610460
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71697AT Annotation by Michelle Graham. TAIR10: choline kinase 1 | chr1:26971537-26973177 FORWARD LENGTH=346 SoyBaseE_val: 3.00E-28ISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004103GO-mf Annotation by Michelle Graham. GO Molecular Function: choline kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0016773GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor SoyBaseN/AISS
PTHR22603Panther CHOLINE/ETHANOALAMINE KINASE RELATED JGI ISS
PTHR22603:SF8Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_I1LDC6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDC6_SOYBN SoyBaseE_val: 4.00E-50ISS
UniRef100_Q42810UniRef Annotation by Michelle Graham. Most informative UniRef hit: GmCK2p n=1 Tax=Glycine max RepID=Q42810_SOYBN SoyBaseE_val: 1.00E-49ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g27385 not represented in the dataset

Glyma01g27385 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g112000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g27385.1   sequence type=CDS   gene model=Glyma01g27385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATGCAACTCTTCTGAATCTCATTTATGTCTCAAATTTATAGTGGCAACTGGCAACTCCTTGCACACAGGCAACAAACCAAGCAATGCTAAAGTGAACCAGTTAGTGAAAGCTGCAGAAAAATACACTCTTGCAAACCATCTATTTTGGGGTTTGTGGGGACTTATTTCGAGTTATGTGAACAAAATTGACTTTGACTATAAGGAGTATGGAAGGCAGAGGTTTCAACAATACTGGATAAGGAAGCCTAGTTTATTGGACTCGCCAAGCATCATTTCCCTAGATGAAACTGTGAATGGATTGTTGCCATCCTTCACGTGA

>Glyma01g27385.1   sequence type=predicted peptide   gene model=Glyma01g27385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKCNSSESHLCLKFIVATGNSLHTGNKPSNAKVNQLVKAAEKYTLANHLFWGLWGLISSYVNKIDFDYKEYGRQRFQQYWIRKPSLLDSPSIISLDETVNGLLPSFT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo