Glyma01g27301 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g27301): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g27301): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g27301

Feature Type:	gene_model
Chromosome:	Gm01
Start:	36452473
stop:	36453313
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g27301

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G01820	AT	Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein \| chr3:293981-295357 REVERSE LENGTH=263	SoyBase	E_val: 4.00E-28	ISS
GO:0006139	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0009061	GO-bp	Annotation by Michelle Graham. GO Biological Process: anaerobic respiration	SoyBase	N/A	ISS
GO:0009117	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0019205	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleobase-containing compound kinase activity	SoyBase	N/A	ISS
PTHR23359	Panther	ADENYLATE KINASE	JGI		ISS
PF00406	PFAM	Adenylate kinase	JGI		ISS
UniRef100_Q38HW2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Adenylate kinase family-like protein n=1 Tax=Solanum tuberosum RepID=Q38HW2_SOLTU	SoyBase	E_val: 2.00E-33	ISS
UniRef100_UPI0002336B5C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002336B5C related cluster n=1 Tax=unknown RepID=UPI0002336B5C	SoyBase	E_val: 4.00E-88	ISS

Expression Patterns of Glyma01g27301

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g27301 not represented in the dataset	Glyma01g27301 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g27301 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g111700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g27301

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g27301

Limit To All Plant Sequences

>Glyma01g27301.1   sequence type=CDS   gene model=Glyma01g27301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGATAGCACATTCCTTGGATCATGGAAAACTTGTCCCTGATGATATTATTTTTGGGCTACTATCGAAGAGATTGGAGGATGGATACTCAAGAGGCCAAACTGGGTTCATTCTTGATGGATTCCCTCGAACAAGGATTCAAGCTGAGATTCTTGACCACATTGCTCATGTTGATCTGGTGCTGAATTTCAAGTTCAGAAGAGGACTTAATGAAAAAGAATCTAGGAACTCGAAATTTAATGCTTACCAAGAATATATTCTTATGACTAGCTCCAGGACAACAAAACAATTGGAGGATGATCATGACCAAAGTCATGCAAAGGAGTGCAATCTGTTGGAAGATTACTACAGGAAGCAGAAGAAGCTTCTTAACTTTGAAGTAGCTAAATGA

Predicted protein sequences of Glyma01g27301

Limit To All Plant Sequences

>Glyma01g27301.1   sequence type=predicted peptide   gene model=Glyma01g27301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQIAHSLDHGKLVPDDIIFGLLSKRLEDGYSRGQTGFILDGFPRTRIQAEILDHIAHVDLVLNFKFRRGLNEKESRNSKFNAYQEYILMTSSRTTKQLEDDHDQSHAKECNLLEDYYRKQKKLLNFEVAK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain