Report for Sequence Feature Glyma01g27230
Feature Type: gene_model
Chromosome: Gm01
Start: 36326564
stop: 36327062
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma01g27230
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G24550 AT
Annotation by Michelle Graham. TAIR10: Clathrin adaptor complexes medium subunit family protein | chr4:12675873-12678689 FORWARD LENGTH=385
SoyBase E_val: 5.00E-22 ISS
GO:0006623 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole
SoyBase N/A ISS
GO:0006810 GO-bp
Annotation by Michelle Graham. GO Biological Process: transport
SoyBase N/A ISS
GO:0006886 GO-bp
Annotation by Michelle Graham. GO Biological Process: intracellular protein transport
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0030125 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: clathrin vesicle coat
SoyBase N/A ISS
PTHR11998 Panther
CLATHRIN COAT ASSEMBLY PROTEIN
JGI ISS
PTHR11998:SF13 Panther
CLATHRIN COAT ASSEMBLY PROTEIN AP50
JGI ISS
UniRef100_B9RJW2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AP-4 complex subunit mu-1, putative n=1 Tax=Ricinus communis RepID=B9RJW2_RICCO
SoyBase E_val: 2.00E-20 ISS
UniRef100_I1JT85 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JT85_SOYBN
SoyBase E_val: 5.00E-24 ISS
Expression Patterns of Glyma01g27230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma01g27230 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma01g27230
Coding sequences of Glyma01g27230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma01g27230.1 sequence type=CDS gene model=Glyma01g27230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GATTTTGGTTATGTGCAAACAACATCCACTGAGGATTTGAAGTCATATGTTTATTCAGTTACTTGCTTCAGGCATATTATTGGTTGTACAACTATTACAAAGTCTGTGGTTGCTAATGAACCCGGTGGAAGGAAGAGGGATGAGATCTTTGTTGATGTAATTGAGAAAATAAGTGTTACATTCAACTCTAGTGGATTTATACTTACT
Predicted protein sequences of Glyma01g27230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma01g27230.1 sequence type=predicted peptide gene model=Glyma01g27230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
DFGYVQTTSTEDLKSYVYSVTCFRHIIGCTTITKSVVANEPGGRKRDEIFVDVIEKISVTFNSSGFILT