SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g27145

Feature Type:gene_model
Chromosome:Gm01
Start:36192775
stop:36194659
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g27145
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30330AT Annotation by Michelle Graham. TAIR10: auxin response factor 6 | chr1:10686125-10690036 REVERSE LENGTH=935 SoyBaseE_val: 7.00E-82ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009725GO-bp Annotation by Michelle Graham. GO Biological Process: response to hormone stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF02362PFAM B3 DNA binding domain JGI ISS
UniRef100_B9T414UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin response factor, putative n=1 Tax=Ricinus communis RepID=B9T414_RICCO SoyBaseE_val: 6.00E-84ISS
UniRef100_UPI000233AAEBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AAEB related cluster n=1 Tax=unknown RepID=UPI000233AAEB SoyBaseE_val: 3.00E-84ISS

Expression Patterns of Glyma01g27145
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g27145 not represented in the dataset
Glyma01g27145 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g27145 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g27145
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g27145
>Glyma01g27145.1   sequence type=CDS   gene model=Glyma01g27145   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGGGAAGTAGATGCTCATATCCCAAACTATCCAAGCTTGCCTCCTCAACTCATTTGTCAACTTCCTAATATGACTATGCATGCTGATGCCAAGACCGATGAAGTGTACTCGCAAATGACCTTGCAACCTCTGAATCTTCCAGCAGAGCTGGTCACCCCAAGTAAACAACCAACAAACTATTTCTACAAAACTTTGACAATCAGTGGCGCAAGCACTCATGGGGGATTCTCTGTGCCTCGTAGGGCAGTTGAAAAAGTGTTTCCTCCATTGGATTTCTCTCAACAACCTCCTGCTCAAGAATTAATTGCAAGGGATATGCATGGTAATGAGTGGAAATTCAGGCATATCTTCCGGGGCCAGCCCAAAAGGCATCTACTTACAACCGGATGGAGTGTCTTTGTGGCTGCTAAAAGACTAGTTGTTGGTGATTCTATGTTGTTTATCTGGCAAGTAATTTTATTGTTTCCATCCCCCCAAAAAAGGATTTTAAAAATTAAAACATGGCTTTGGCTTGGATTGCAAGTTGGCTGGGATGAATCCACAACTGGAGATAGGCAACCTAGAGTGTCTCTATGGGAAATTGAGCCATTAACTACATTTCCTATGTACCCATCTCGATTCCCCCTTAGGCTTCAATGGCCATGGCCTCTAGGACTGCCTTCGTTCCAT
Predicted protein sequences of Glyma01g27145
>Glyma01g27145.1   sequence type=predicted peptide   gene model=Glyma01g27145   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGEVDAHIPNYPSLPPQLICQLPNMTMHADAKTDEVYSQMTLQPLNLPAELVTPSKQPTNYFYKTLTISGASTHGGFSVPRRAVEKVFPPLDFSQQPPAQELIARDMHGNEWKFRHIFRGQPKRHLLTTGWSVFVAAKRLVVGDSMLFIWQVILLFPSPQKRILKIKTWLWLGLQVGWDESTTGDRQPRVSLWEIEPLTTFPMYPSRFPLRLQWPWPLGLPSFH






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo