SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g26940

Feature Type:gene_model
Chromosome:Gm01
Start:35863798
stop:35865409
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g26940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G01090AT Annotation by Michelle Graham. TAIR10: Concanavalin A-like lectin family protein | chr5:33055-34116 FORWARD LENGTH=353 SoyBaseE_val: 9.00E-60ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
PTHR11795Panther PROTEIN KINASE JGI ISS
PTHR11795:SF43Panther RECEPTOR LECTIN KINASE 3-RELATED JGI ISS
PF00139PFAM Legume lectin domain JGI ISS
UniRef100_G7JR99UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lectin n=2 Tax=Medicago truncatula RepID=G7JR99_MEDTR SoyBaseE_val: 2.00E-138ISS
UniRef100_I1J751UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J751_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma01g26940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g26940
ParalogEvidenceComments
Glyma03g15030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g26940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g109200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g26940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g26940
>Glyma01g26940.1   sequence type=CDS   gene model=Glyma01g26940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCATTTCCCACTTCCCATTATTACTTCAGGGCCTTCACTTTCTCCATTTTGTTCCTCAAAACCCTAGCTTTTGACCCAATTCCTCTGTTTTATTATGCTGGCTTTGGAAAAGATCTGAAATTTACGCCCAACGTGGCCCTTTTTGGTAATGCAAAGGTTCTCAACGAAGGGTCTGGGATTCATTTCTCTGGCTCTGGGAGTTCAGGAGACACTGGGAGAGTCATGTACAAGAAACCCATCAAGCTTTTTCAAGGTAAACCAAGGCAATTAGTGTCTTTTTCTACTTACTTTGCATTTTCAGTCTCATTGGAAGATGGGGGTGGCTTGGCTTTTGTTATGGCTCCAAAGGGTTCTGAAGGTGATATGTTTTATCAAAGTTCTTATGGGTTGAATAGTAGAAAATTTGAAGTTGTTGGTGTTGAGTTTAGTGCCTCAAAGGGTGGTAGAAAAGGGGTTTCTTCTAGTTGTCATGTCAACATGAATATTGGTGGTTTTGTTGCTAAAAAAAGTAACACCTCTATTGGAGAAAAGTTGCATGTTTGGATTGACTATGAAGCTAGTTCAAAGCGCTTAGAAGTGAGACTGAGTCAGCATGGTAAATCGAGGCCATCTTATCCATTGCTGTGGCAATCAATTGACTTGTCAAATGTGTTGAAGGAGAAAGAAATGTTGGTGGGTTTTAGTTCTGTGAAGGGGAATGACTCTCAAGCATGCTTTCTATATTCATGGAGCTTTGTTCTGAGGAATTTCCCACATTCAATGCATTCAGAGCCCTTGGATCCAAAGGTCTTTGTCAAAAACACTGAAAGTCCAGTGGTTAAACAAAGGAGTGATTGCTTTTTGAGAGTTCTTGCTGCAATGATATTTGGTACTGGATGTGGAGCTTTGACAGCATTTATTGTGCTTTACTTGTGGACCATCTTTGGCAACAATAAACGTGCTGTGGTGCCAGAGGAATCTGTTGTGCAACCTGTAGATGTTGAATATAGGAAAAATGTCAGAATTGTTGTAGATAAAACCATCGAAGATGGTAAGAAGTAG
Predicted protein sequences of Glyma01g26940
>Glyma01g26940.1   sequence type=predicted peptide   gene model=Glyma01g26940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPFPTSHYYFRAFTFSILFLKTLAFDPIPLFYYAGFGKDLKFTPNVALFGNAKVLNEGSGIHFSGSGSSGDTGRVMYKKPIKLFQGKPRQLVSFSTYFAFSVSLEDGGGLAFVMAPKGSEGDMFYQSSYGLNSRKFEVVGVEFSASKGGRKGVSSSCHVNMNIGGFVAKKSNTSIGEKLHVWIDYEASSKRLEVRLSQHGKSRPSYPLLWQSIDLSNVLKEKEMLVGFSSVKGNDSQACFLYSWSFVLRNFPHSMHSEPLDPKVFVKNTESPVVKQRSDCFLRVLAAMIFGTGCGALTAFIVLYLWTIFGNNKRAVVPEESVVQPVDVEYRKNVRIVVDKTIEDGKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo