SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g26813

Feature Type:gene_model
Chromosome:Gm01
Start:35625154
stop:35625890
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g26813
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18800AT Annotation by Michelle Graham. TAIR10: NAP1-related protein 2 | chr1:6481466-6483463 REVERSE LENGTH=256 SoyBaseE_val: 2.00E-41ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003682GO-mf Annotation by Michelle Graham. GO Molecular Function: chromatin binding SoyBaseN/AISS
GO:0042393GO-mf Annotation by Michelle Graham. GO Molecular Function: histone binding SoyBaseN/AISS
PTHR11875Panther NUCLEOSOME ASSEMBLY PROTEIN JGI ISS
PTHR11875:SF47Panther JGI ISS
PF00956PFAM Nucleosome assembly protein (NAP) JGI ISS
UniRef100_Q9M9V0UniRef Annotation by Michelle Graham. Most informative UniRef hit: F6A14.10 protein n=1 Tax=Arabidopsis thaliana RepID=Q9M9V0_ARATH SoyBaseE_val: 7.00E-39ISS
UniRef100_UPI0002337AE9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337AE9 related cluster n=1 Tax=unknown RepID=UPI0002337AE9 SoyBaseE_val: 2.00E-49ISS

Expression Patterns of Glyma01g26813
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g26813 not represented in the dataset
Glyma01g26813 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g26813 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g108500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g26813
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g26813
>Glyma01g26813.1   sequence type=CDS   gene model=Glyma01g26813   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTCATCCTGCCCTTTGTGAACTTCTGAACGTAGAGGATCAAAAGATATTTAAGTATTTGGGTTCTCTTGATGTTGAAGATTATAAAGATGTCAAATCAGGCTACTCAATCACCTTTAATTTCAATCCCAATCCCTATTTTCATAATACAAAGCTTACAAAGACTTTTACCTTCCTTGAAGAAGGAACAACAAAGATAACTGTTACCCCCATAAAATGGAAAGAGGGCAAGGATTACCCAATGGACTTGATCATGACAAGAATGGGAACAAGTAGGTCGTATTGA
Predicted protein sequences of Glyma01g26813
>Glyma01g26813.1   sequence type=predicted peptide   gene model=Glyma01g26813   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHPALCELLNVEDQKIFKYLGSLDVEDYKDVKSGYSITFNFNPNPYFHNTKLTKTFTFLEEGTTKITVTPIKWKEGKDYPMDLIMTRMGTSRSY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo