|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G09220 | AT | Annotation by Michelle Graham. TAIR10: laccase 7 | chr3:2827434-2830477 REVERSE LENGTH=567 | SoyBase | E_val: 5.00E-25 | ISS |
| GO:0000041 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transition metal ion transport | SoyBase | N/A | ISS |
| GO:0006826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron ion transport | SoyBase | N/A | ISS |
| GO:0010106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation | SoyBase | N/A | ISS |
| GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
| GO:0015706 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate transport | SoyBase | N/A | ISS |
| GO:0046274 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lignin catabolic process | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0052716 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydroquinone:oxygen oxidoreductase activity | SoyBase | N/A | ISS |
| PTHR11709 | Panther | MULTI-COPPER OXIDASE | JGI | ISS | |
| PTHR11709:SF9 | Panther | LACCASE | JGI | ISS | |
| PF07732 | PFAM | Multicopper oxidase | JGI | ISS | |
| UniRef100_G7JS86 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Laccase n=1 Tax=Medicago truncatula RepID=G7JS86_MEDTR | SoyBase | E_val: 1.00E-30 | ISS |
| UniRef100_I1JLV9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLV9_SOYBN | SoyBase | E_val: 1.00E-37 | ISS |
|
Glyma01g26783 not represented in the dataset |
Glyma01g26783 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g108300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g26783.1 sequence type=CDS gene model=Glyma01g26783 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAATCTTTGTGTGTTTCCTTTGGCCTGGGATTTTGCTCTTTTGCTAGCATGTTCCTTGATTTCTGCTGCTGTTGTGGAACACACTTTCAATGTGGCGGACATTACTGTGCAGCGTTTGTGTCGTCAACAACTAATCACTGCCGCCAATAGAACCCTGCCAGGACCAACAATTAACGCTCGAGAAGGTGATACTGTTGTCGTTCACGTATTCAACAAGTCACCCTACAATCTTACTATTCATTGGTATACCTTTTCTCCTCCATCGATCATATCAATAATGAAATAA
>Glyma01g26783.1 sequence type=predicted peptide gene model=Glyma01g26783 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNLCVFPLAWDFALLLACSLISAAVVEHTFNVADITVQRLCRQQLITAANRTLPGPTINAREGDTVVVHVFNKSPYNLTIHWYTFSPPSIISIMK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||