SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g26783

Feature Type:gene_model
Chromosome:Gm01
Start:35595557
stop:35596652
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g26783
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09220AT Annotation by Michelle Graham. TAIR10: laccase 7 | chr3:2827434-2830477 REVERSE LENGTH=567 SoyBaseE_val: 5.00E-25ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0046274GO-bp Annotation by Michelle Graham. GO Biological Process: lignin catabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0052716GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroquinone:oxygen oxidoreductase activity SoyBaseN/AISS
PTHR11709Panther MULTI-COPPER OXIDASE JGI ISS
PTHR11709:SF9Panther LACCASE JGI ISS
PF07732PFAM Multicopper oxidase JGI ISS
UniRef100_G7JS86UniRef Annotation by Michelle Graham. Most informative UniRef hit: Laccase n=1 Tax=Medicago truncatula RepID=G7JS86_MEDTR SoyBaseE_val: 1.00E-30ISS
UniRef100_I1JLV9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLV9_SOYBN SoyBaseE_val: 1.00E-37ISS

Expression Patterns of Glyma01g26783
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g26783 not represented in the dataset
Glyma01g26783 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g26783 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g108300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g26783
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g26783
>Glyma01g26783.1   sequence type=CDS   gene model=Glyma01g26783   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCTTTGTGTGTTTCCTTTGGCCTGGGATTTTGCTCTTTTGCTAGCATGTTCCTTGATTTCTGCTGCTGTTGTGGAACACACTTTCAATGTGGCGGACATTACTGTGCAGCGTTTGTGTCGTCAACAACTAATCACTGCCGCCAATAGAACCCTGCCAGGACCAACAATTAACGCTCGAGAAGGTGATACTGTTGTCGTTCACGTATTCAACAAGTCACCCTACAATCTTACTATTCATTGGTATACCTTTTCTCCTCCATCGATCATATCAATAATGAAATAA
Predicted protein sequences of Glyma01g26783
>Glyma01g26783.1   sequence type=predicted peptide   gene model=Glyma01g26783   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLCVFPLAWDFALLLACSLISAAVVEHTFNVADITVQRLCRQQLITAANRTLPGPTINAREGDTVVVHVFNKSPYNLTIHWYTFSPPSIISIMK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo