|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G61900 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: anchored to plasma membrane, plasma membrane, anchored to membrane; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G30700.1); Has 65 Blast hits to 65 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 65; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | | SoyBase | E_val: 2.00E-28 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0031225 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane | SoyBase | N/A | ISS |
| GO:0046658 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_G7JDI2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: GPI-anchored protein, putative n=1 Tax=Medicago truncatula RepID=G7JDI2_MEDTR | SoyBase | E_val: 1.00E-24 | ISS |
| UniRef100_UPI000233C480 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C480 related cluster n=1 Tax=unknown RepID=UPI000233C480 | SoyBase | E_val: 7.00E-39 | ISS |
|
Glyma01g26766 not represented in the dataset |
Glyma01g26766 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g26766.1 sequence type=CDS gene model=Glyma01g26766 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTTGAATTTGGATGTTCTCTCCCCCTTTCTCTTACTATCTTATCCGTGTATCTTGCAGGACTTTGCACTTTGAACTTTACTACTGCTAAAAGTTTGATAAGTGTGACAGCAATTGATTGCTGGGAAGTTTTTGCGCCATTTCTGGCTAATGTGATATGTTGCCCCCAATTGGAAGCCACTCTCACAATTCTTATTGGTCAATCCAATAAACATTCCAATGTACTTGCCTTAAACGAGAACGATGCTAAACATTGCCTGGCAGATGTGGAACAAATTTTGATCTGCCGAGACATGATTTGCGGCATTATAATTGTATTTATTCATTATTACTAA
>Glyma01g26766.1 sequence type=predicted peptide gene model=Glyma01g26766 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLEFGCSLPLSLTILSVYLAGLCTLNFTTAKSLISVTAIDCWEVFAPFLANVICCPQLEATLTILIGQSNKHSNVLALNENDAKHCLADVEQILICRDMICGIIIVFIHYY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||