SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g26681

Feature Type:gene_model
Chromosome:Gm01
Start:35464371
stop:35465052
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g26681
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G35695AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Putative harbinger transposase-derived nuclease (InterPro:IPR006912); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41980.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:13869120-13869941 FORWARD LENGTH=211 SoyBaseE_val: 1.00E-34ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
PTHR22930Panther UNCHARACTERIZED JGI ISS
PF04827PFAM Plant transposon protein JGI ISS
UniRef100_E5GBB2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Retrotransposon protein n=1 Tax=Cucumis melo subsp. melo RepID=E5GBB2_CUCME SoyBaseE_val: 6.00E-47ISS
UniRef100_UPI000233B5ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B5AD related cluster n=1 Tax=unknown RepID=UPI000233B5AD SoyBaseE_val: 5.00E-112ISS

Expression Patterns of Glyma01g26681
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g26681 not represented in the dataset
Glyma01g26681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g26681 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g26681
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g26681
>Glyma01g26681.1   sequence type=CDS   gene model=Glyma01g26681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTAAGGTTTATTTATGTGTTACCTGGGTGGGAAGGGTCTGCAGGAGATTCTCGAGTATTACGAGATGCATTACATCGTCAAAACAACTTGAAATTCCAACTGTTTAAGTCTATGTTTGTTATTTTAAACATTGTAGGTAAGTATTTTCTTGTGGATGCGGGATATACCAATGGTCCGGGATTTTTAGCACCATATCGAGGGACTAGATATCATCTCAATGAGTGGATTGGAAACACCCCTCAAAGTTACAAGGAGTTATTTAATCTTCATCATGCAAGTGTCCGAAATGCAATAGAAAGGTCATTTGGGATCTTGAAAAAAATATGGAGTATATTAAGAACTCCTTCATTTTTTGATATAAAGACACAAATAAGAATCATCAATGCTTGTTTTGTGTCACACAATTTCATAAGAGACGAACAACAAACTGATCAACTTTTAGAAGTTCAAGACTTAGAATTTTTATCTGTTGTTGATGAAGAGTTAGTCCATCAATCAAGGGAAGAAGTTCAAAATAATGCCATAGATGATATCACAACTATTCAAGATACCGAGGAATGGACAAGATTTCGAGATACATTAGCTATGAATATGTTTGCTAACTATCAAGTTAGGAGAAACTTTGCTTATGGATAG
Predicted protein sequences of Glyma01g26681
>Glyma01g26681.1   sequence type=predicted peptide   gene model=Glyma01g26681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LRFIYVLPGWEGSAGDSRVLRDALHRQNNLKFQLFKSMFVILNIVGKYFLVDAGYTNGPGFLAPYRGTRYHLNEWIGNTPQSYKELFNLHHASVRNAIERSFGILKKIWSILRTPSFFDIKTQIRIINACFVSHNFIRDEQQTDQLLEVQDLEFLSVVDEELVHQSREEVQNNAIDDITTIQDTEEWTRFRDTLAMNMFANYQVRRNFAYG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo