Glyma01g26620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g26620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g26620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g26620

Feature Type:	gene_model
Chromosome:	Gm01
Start:	35271481
stop:	35272153
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g26620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G09660	AT	Annotation by Michelle Graham. TAIR10: peroxisomal NAD-malate dehydrogenase 2 \| chr5:2993645-2995169 REVERSE LENGTH=333	SoyBase	E_val: 8.00E-46	ISS
GO:0000096	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process	SoyBase	N/A	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006108	GO-bp	Annotation by Michelle Graham. GO Biological Process: malate metabolic process	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006546	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine catabolic process	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006636	GO-bp	Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0006733	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process	SoyBase	N/A	ISS
GO:0006766	GO-bp	Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process	SoyBase	N/A	ISS
GO:0008652	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0009072	GO-bp	Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process	SoyBase	N/A	ISS
GO:0009106	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process	SoyBase	N/A	ISS
GO:0009108	GO-bp	Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process	SoyBase	N/A	ISS
GO:0009117	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process	SoyBase	N/A	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009902	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast relocation	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010103	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0010304	GO-bp	Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015994	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0016117	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019216	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019748	GO-bp	Annotation by Michelle Graham. GO Biological Process: secondary metabolic process	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0031408	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process	SoyBase	N/A	ISS
GO:0031998	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0044242	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular lipid catabolic process	SoyBase	N/A	ISS
GO:0044262	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0044272	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0080093	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of photorespiration	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0042579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: microbody	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016615	GO-mf	Annotation by Michelle Graham. GO Molecular Function: malate dehydrogenase activity	SoyBase	N/A	ISS
GO:0016616	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	SoyBase	N/A	ISS
GO:0030060	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-malate dehydrogenase activity	SoyBase	N/A	ISS
PTHR11540	Panther	MALATE AND LACTATE DEHYDROGENASE	JGI		ISS
PTHR11540:SF1	Panther	MALATE DEHYDROGENASE	JGI		ISS
PF00056	PFAM	lactate/malate dehydrogenase, NAD binding domain	JGI		ISS
PF02866	PFAM	lactate/malate dehydrogenase, alpha/beta C-terminal domain	JGI		ISS
UniRef100_C6TE03	UniRef	Annotation by Michelle Graham. Best UniRef hit: Malate dehydrogenase n=1 Tax=Glycine max RepID=C6TE03_SOYBN	SoyBase	E_val: 3.00E-47	ISS
UniRef100_C6TE03	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Malate dehydrogenase n=1 Tax=Glycine max RepID=C6TE03_SOYBN	SoyBase	E_val: 3.00E-47	ISS

Expression Patterns of Glyma01g26620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g26620 not represented in the dataset	Glyma01g26620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g26620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g26620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g26620

Limit To All Plant Sequences

>Glyma01g26620.1   sequence type=CDS   gene model=Glyma01g26620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTTCCAAGTGTTGCCACAATGCAATTGTCAACTTGATTAGTAATCCAGTGAATTCCATAGTTTCTATAGTTGCGGAGGTTTTCTTGAAAGCTTGTACATATGATCCAAAGCGACTATTGGGTGTTACAACCATGGATGTTGTGAGGGCAAATACTTTTGTACTTGGAGTTGATCCAAGAGAGGTTGATGTTCCAGTGGTTGGAGGTCATGCTGGAGTCACAATTTTTCCTCTTTTGTCACAGGTTAAGCCTCCCAGTAGCTTCACGGCAGAAATCACATCCAAAATGGTGGAATTGAAGTTGTTG

Predicted protein sequences of Glyma01g26620

Limit To All Plant Sequences

>Glyma01g26620.1   sequence type=predicted peptide   gene model=Glyma01g26620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LSKCCHNAIVNLISNPVNSIVSIVAEVFLKACTYDPKRLLGVTTMDVVRANTFVLGVDPREVDVPVVGGHAGVTIFPLLSQVKPPSSFTAEITSKMVELKLL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain