SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g26606

Feature Type:gene_model
Chromosome:Gm01
Start:35221754
stop:35222332
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g26606
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG01130AT Annotation by Michelle Graham. TAIR10: Ycf1 protein | chrC:123884-129244 REVERSE LENGTH=1786 SoyBaseE_val: 2.00E-16ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF05758PFAM Ycf1 JGI ISS
UniRef100_I2E2U4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hypothetical chloroplast RF19 n=1 Tax=Vigna unguiculata RepID=I2E2U4_VIGUN SoyBaseE_val: 4.00E-24ISS
UniRef100_Q2PMP0UniRef Annotation by Michelle Graham. Best UniRef hit: Putative membrane protein ycf1 n=1 Tax=Glycine max RepID=YCF1_SOYBN SoyBaseE_val: 7.00E-30ISS

Expression Patterns of Glyma01g26606
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g26606 not represented in the dataset
Glyma01g26606 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g26606 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g107300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g26606
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g26606
>Glyma01g26606.1   sequence type=CDS   gene model=Glyma01g26606   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATTAATACATTATTCCCAACAATCGGATTTTCAGCGAGACATAATCAAAGAATCTATACGTGCTCAAAGGTGTAAAACAGTTACTTGGAAATTTTTTCAAAAAAGGGTGCATTCCCCCCTTTTTTGGATAAAATTGAAAAACCTTTTTTTTTGTTTTGATAGTTTCAAATCAATGAAAATCTTTTTTATGTTCAAAATTTGGATGCGAAAAAACTCCACCACATCCATGGTCGAAAGTGACGTTGAAGCCTTGGGCCATTATGGATTGACTATGGCCCTCTTGGATGACCACGACACTCATGAATTTGAGCAAGACACTCATGAATTTACCATGACCCTCATGAATTGA
Predicted protein sequences of Glyma01g26606
>Glyma01g26606.1   sequence type=predicted peptide   gene model=Glyma01g26606   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALIHYSQQSDFQRDIIKESIRAQRCKTVTWKFFQKRVHSPLFWIKLKNLFFCFDSFKSMKIFFMFKIWMRKNSTTSMVESDVEALGHYGLTMALLDDHDTHEFEQDTHEFTMTLMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo