Glyma01g26360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g26360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g26360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g26360

Feature Type:	gene_model
Chromosome:	Gm01
Start:	34923321
stop:	34923989
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g26360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26975	AT	Annotation by Michelle Graham. TAIR10: Ctr copper transporter family \| chr2:11512992-11513429 FORWARD LENGTH=145	SoyBase	E_val: 6.00E-30	ISS
GO:0006825	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transport	SoyBase	N/A	ISS
GO:0035434	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transmembrane transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005375	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion transmembrane transporter activity	SoyBase	N/A	ISS
KOG3386	KOG	Copper transporter	JGI		ISS
PTHR12483	Panther	SOLUTE CARRIER FAMILY 31 (COPPER TRANSPORTERS)	JGI		ISS
PTHR12483:SF1	Panther	gb def: f31e8.4.p [caenorhabditis elegans]	JGI		ISS
PF04145	PFAM	Ctr copper transporter family	JGI		ISS
UniRef100_B9HC67	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Copper transporter n=1 Tax=Populus trichocarpa RepID=B9HC67_POPTR	SoyBase	E_val: 1.00E-42	ISS
UniRef100_I1J731	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J731_SOYBN	SoyBase	E_val: 1.00E-100	ISS

Expression Patterns of Glyma01g26360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g26360 not represented in the dataset	Glyma01g26360 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g26360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g106700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g26360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g26360

Limit To All Plant Sequences

>Glyma01g26360.2   sequence type=CDS   gene model=Glyma01g26360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCCATGTTCCTTGCATTAGTAAGATAAATATTTATATAGCCAAAACTCCTCACAAACATCAACTTCTCTCTCTCTCTCTCTCTGAGTATACCTGTGGGTGTGTATCAATTAACCAAAAGATGGAAATGCATCCAGGAGATGACATGCCAATGTCTAATGGAAGAGATCATAATAGCATGAAGATGCACATGAGCCTCTATTGGGGCAAAGATGCCATAGTACTTTTCTCTGGGTGGCCTAAGCACAGTGTTGGCCACTACATCTTGGCCATCTTGTTTGTGTTTTTCCTTGCAATCATTGCCGAGGTTGTCTCCAACAAACCCAACATCAAGCGTGGGACTAATCCTATAATAGGAGGGTTGGCTCAAGCAACCTTCTATGTCTTCCGCATAAGCTTACTTTACTTGGTCATGCTTGCTGTCATGTCCTTCAATTTGGGAATCTTCATAGCTGCTGTAGCTGGCCACACCTTGGGCTTCTTCCTTGCCAAGTCTCGTGCTTTAGCTCTTGCCAATAGAGAACAAGAGTCCTCCTCGGATGCTCAAAAAGTTTGA

Predicted protein sequences of Glyma01g26360

Limit To All Plant Sequences

>Glyma01g26360.2   sequence type=predicted peptide   gene model=Glyma01g26360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGHVPCISKINIYIAKTPHKHQLLSLSLSEYTCGCVSINQKMEMHPGDDMPMSNGRDHNSMKMHMSLYWGKDAIVLFSGWPKHSVGHYILAILFVFFLAIIAEVVSNKPNIKRGTNPIIGGLAQATFYVFRISLLYLVMLAVMSFNLGIFIAAVAGHTLGFFLAKSRALALANREQESSSDAQKV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain