SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g25916

Feature Type:gene_model
Chromosome:Gm01
Start:34210141
stop:34210872
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g25916
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09280AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: root; Has 31 Blast hits to 31 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 31; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:2850920-2851258 REVERSE LENGTH=112 SoyBaseE_val: 3.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JLZ8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLZ8_SOYBN SoyBaseE_val: 5.00E-89ISS
UniRef100_Q9SR35UniRef Annotation by Michelle Graham. Most informative UniRef hit: F3L24.15 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SR35_ARATH SoyBaseE_val: 2.00E-08ISS

Expression Patterns of Glyma01g25916
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g25916 not represented in the dataset
Glyma01g25916 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g25916
ParalogEvidenceComments
Glyma03g16890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g25916 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g105300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g25916
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g25916
>Glyma01g25916.1   sequence type=CDS   gene model=Glyma01g25916   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTAAGTTTCTTTTCTTAAGCTTTCTTTTAGCAAATACCCTTTTGAGTCTAACCAATGCAACAAACCAACCTCAAATCATTTTCCAATCTTTTTCAGCACCGTCTTCAAACCCTCCTTCTCAGAGTCCATCTAGTGGCCAAAGACCACGCACATCAGAACCCTCTATTGGAAGGAAACTTGGTATGCACCGACATAACCAAATCAGGTCCTCTGACACCAAAAGTCCTACCCCATCTGAAGCACCACAAAGTGAAAAGAAGATGCACTCTATTTCTGAAGGGAGCATTCCTAGTCATCAGAGAACTTCTATTGAACCACATGATGGAGAAGTTTTGGGTTCTCATCATGGCCAGGTCCATTTGTCAAAGCAGCGCCACCACTCATTTGACAAGTCCAGAGCTGGAGCAGGAGTTATTCTTGTTGGGCTTGCTACCACATTTTTGGTGTCAGTTTTCTGTTATATAAGAGCCACTAGAAGGAACAAGCTAGAAACAACAGCTTAG
Predicted protein sequences of Glyma01g25916
>Glyma01g25916.1   sequence type=predicted peptide   gene model=Glyma01g25916   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKFLFLSFLLANTLLSLTNATNQPQIIFQSFSAPSSNPPSQSPSSGQRPRTSEPSIGRKLGMHRHNQIRSSDTKSPTPSEAPQSEKKMHSISEGSIPSHQRTSIEPHDGEVLGSHHGQVHLSKQRHHSFDKSRAGAGVILVGLATTFLVSVFCYIRATRRNKLETTA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo