|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G47470 | AT | Annotation by Michelle Graham. TAIR10: thioredoxin family protein | chr2:19481503-19483683 FORWARD LENGTH=361 | SoyBase | E_val: 6.00E-23 | ISS |
| GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006662 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process | SoyBase | N/A | ISS |
| GO:0009553 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac development | SoyBase | N/A | ISS |
| GO:0009567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm | SoyBase | N/A | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0045454 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0048868 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube development | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| GO:0003756 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0015035 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0016853 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: isomerase activity | SoyBase | N/A | ISS |
| PF07749 | PFAM | Endoplasmic reticulum protein ERp29, C-terminal domain | JGI | ISS | |
| UniRef100_E3W9C2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase S-1 (Fragment) n=1 Tax=Glycine max RepID=E3W9C2_SOYBN | SoyBase | E_val: 5.00E-34 | ISS |
| UniRef100_UPI0002337AD7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002337AD7 related cluster n=1 Tax=unknown RepID=UPI0002337AD7 | SoyBase | E_val: 2.00E-38 | ISS |
|
Glyma01g25193 not represented in the dataset |
Glyma01g25193 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g103400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g25193.1 sequence type=CDS gene model=Glyma01g25193 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAGAGGAAGTTGAGAATCTGAAGGGTTCTGCCTCAAGGCACGAGAAGATTTACTTGAAAGCTGCCAAGAATTACTTGGAAAAAGGTTCTGATTATGCTAAGAACGAAATCCAGTGCCTACAGCGCATACTTGACAAGCCCATTAGTCCTGCGAAGGCCGACGAGTTAACTCTAAAGAAAAATATCTTGTCGACATATGCTGCTTGA
>Glyma01g25193.1 sequence type=predicted peptide gene model=Glyma01g25193 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEEEVENLKGSASRHEKIYLKAAKNYLEKGSDYAKNEIQCLQRILDKPISPAKADELTLKKNILSTYAA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||