SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g25116

Feature Type:gene_model
Chromosome:Gm01
Start:33175921
stop:33176216
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g25116
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47470AT Annotation by Michelle Graham. TAIR10: thioredoxin family protein | chr2:19481503-19483683 FORWARD LENGTH=361 SoyBaseE_val: 1.00E-27ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0009553GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac development SoyBaseN/AISS
GO:0009567GO-bp Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048868GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube development SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0003756GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
GO:0016853GO-mf Annotation by Michelle Graham. GO Molecular Function: isomerase activity SoyBaseN/AISS
PTHR18929Panther PROTEIN DISULFIDE ISOMERASE JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_E3W9C2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase S-1 (Fragment) n=1 Tax=Glycine max RepID=E3W9C2_SOYBN SoyBaseE_val: 2.00E-30ISS
UniRef100_I1J705UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J705_SOYBN SoyBaseE_val: 3.00E-31ISS

Expression Patterns of Glyma01g25116
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g25116 not represented in the dataset
Glyma01g25116 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g25116 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g25116
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g25116
>Glyma01g25116.1   sequence type=CDS   gene model=Glyma01g25116   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGACTGTGATGAGCACAAGAGTTTGTGCAGCAAATATGGAGTCTCTGGGTACCCAACAATTCAGTGGTTTCCAAAAGGATCTCTTGAACCCAAAAAGTATGAAGGGCCACGCACTGCTGATTCACTTGCTGAGTTTGTAAATACAGAAGGAGGTACTGCTTGA
Predicted protein sequences of Glyma01g25116
>Glyma01g25116.1   sequence type=predicted peptide   gene model=Glyma01g25116   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTADSLAEFVNTEGGTA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo